SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022971 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022971
Domain Number 1 Region: 510-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 342-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 3 Region: 454-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 233-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-21
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 401-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-21
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 174-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.57e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 7 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-20
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 8 Region: 552-604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 1-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.18e-17
Family KRAB domain (Kruppel-associated box) 0.00078
Further Details:      
 
Domain Number 10 Region: 136-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000624
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 92-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000842
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022971   Gene: ENSBTAG00000016721   Transcript: ENSBTAT00000022971
Sequence length 609
Comment pep:known chromosome:UMD3.1:7:14012314:14014696:-1 gene:ENSBTAG00000016721 transcript:ENSBTAT00000022971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVAFEDVAVNFTLEEWALLGPSQKKLYRDVMRETLSNLALIRDKWEDHNTDDQYKNQERN
LRSHILQRLCESKEGSQGGENSGLIPNLNLNTKNSTKPWECSVCGKVFMSRSSLNRHLRS
HTAPKPSKYHQEYGRKPYKCRVCGKAFSYLQPFQKHESNHGIEKSYKCKECGKSFRYRQS
VRKHERTHTGEKPYQCKQCGKAFRYHQTFQTHERTHTGEKPYECKQCGKALSCPSSFRSH
ERTHTGEKPYECKKCSKAFSCPSSLRKHERTHTGEKPYDCKECGKAFISLGSFQRHMITH
TGVGPYKCKDCGKAFNCPSSYRIHERSHTGEKPYECKQCGRAFSCSSSFRTHERTHTGEK
PYQCKECGKAFHWLTTFQVHVRTHTGEKPYICKQCGKALSCPTSFRRHERTHTAEKPYEC
KQCGKTFSSPLGLQIHERTHTGEKPYKCEKCGKAFVSLTSFRRHMMTHTGDGPYKCTECG
KAFNCPSSFRIHERTHTGEKPYDCKICGKAFSCSSYVQVHERTHTGEKPYECKECGKAFI
YRTTFRGHLRVHTGEKPYKCKDCGKAFSRPSSYRSHERIHTGEKLLECKHCGKAFNWPTS
LHKHVMRMH
Download sequence
Identical sequences F1MEJ1
ENSBTAP00000022971 ENSBTAP00000022971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]