SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023089 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023089
Domain Number 1 Region: 448-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-22
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 2 Region: 364-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.13e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 325-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000728
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 4 Region: 293-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000213
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 5 Region: 410-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000622
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023089   Gene: ENSBTAG00000017365   Transcript: ENSBTAT00000023089
Sequence length 567
Comment pep:known chromosome:UMD3.1:22:15431365:15437006:1 gene:ENSBTAG00000017365 transcript:ENSBTAT00000023089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADIAASCQELLDARSLGPPGPGAVALAQPAAGCTPAAPTYYCDIKQEADAPGLPKIYAR
EGPDPYSVRVEDGAGATGGTVPAALGPAQPFFKEEKEGGVEEAGGPPASLCKLEGGEELE
EELGGSGTYSRREQSQIIVEVNLNNQTLHVSTGPEGKPGAATGPATMVLGREDGLQRHSE
EEEDDEEEEEEEDEEEEEGGGSGAEEEEEDEEGGSQRRMRRMRRRKGTASKRRKRRRKRK
GTASRIRRAQRRRKAADGLGAKVKLEEKQHHPCQKCPRVFNNRWYLEKHMNVTHSRMQIC
DQCGKRFLLESELLLHRQTDCERNIQCVTCGKAFKKLWSLHEHNKIVHGYAEKKFSCEIC
EKKFYTMAHVRKHMVAHTKDMPFTCETCGKSFKRSMSLKVHSLQHSGEKPFRCENCNERF
QYKYQLRSHMSIHIGHKQFMCQWCGKDFNMKQYFDEHMKTHTGEKPYICEICGKSFTSRP
NMKRHRRTHTGEKPYPCDVCGQRFRFSNMLKAHKEKCFRVSHPMASDGAPAAPGLPPAPP
QALPLLPGLPQTLPPPPHLPPPPPLFP
Download sequence
Identical sequences E1BCS5
ENSBTAP00000023089 ENSBTAP00000023089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]