SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023232 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023232
Domain Number 1 Region: 275-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000993
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 308-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000978
Family Classic zinc finger, C2H2 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023232   Gene: ENSBTAG00000017488   Transcript: ENSBTAT00000023232
Sequence length 346
Comment pep:known chromosome:UMD3.1:6:59593804:59610697:1 gene:ENSBTAG00000017488 transcript:ENSBTAT00000023232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLSDKFFQTPEGLSHGMQME
PVDLTVNKRSSPPSAGNSPSSLKFQSSHRRASPGLSLPSSSPPGKKYSPPPPPGVQPFSV
PLSMPPVMAAALSRHGIRSPGILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMENSSSS
MQVPVIESYEKPILQKKIKIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIV
QPGKRPLPVESPDTQRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTW
KFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV
Download sequence
Identical sequences A0A1V0ELF8 E1BIQ9 L8IGB5
NP_001192907.1.59421 NP_001192907.1.76553 XP_005207930.1.76553 XP_005897399.1.15283 XP_010804373.1.76553 XP_010831897.1.44457 ENSBTAP00000023232 9913.ENSBTAP00000023232 ENSBTAP00000023232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]