SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023285 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023285
Domain Number 1 Region: 1162-1219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.84e-19
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 505-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.25e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 963-1019
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.89e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 184-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.27e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 1706-1765
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 653-709
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 1204-1256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000553
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 8 Region: 467-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000145
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 9 Region: 220-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000336
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 698-750
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000116
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 11 Region: 1008-1060
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000406
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 12 Region: 78-127
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000127
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 13 Region: 1641-1695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000101
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 14 Region: 20-72
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000429
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 15 Region: 1755-1787
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000616
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 16 Region: 114-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000219
Family Classic zinc finger, C2H2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023285   Gene: ENSBTAG00000017517   Transcript: ENSBTAT00000023285
Sequence length 1831
Comment pep:known chromosome:UMD3.1:24:2597951:2656107:-1 gene:ENSBTAG00000017517 transcript:ENSBTAT00000023285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGVLTLNAENTNYDYQVPNFHKCEICLLSFPKESQFQRHMRDHERNDKPHRCDQCPQTFN
VEFNLTLHKCTHNGEDPTCPVCNKKFSRVASLKAHVMLHEKEENLICSECGDEFTLQSQL
AIHMEEHRQELAGSRTHTCKACRKEFETSSQLKEHMKTHYKIRDPRVAGTRSYNRNIDRS
SFTYSCPHCGKTFQKPSQLTRHVRIHTGERPFKCSECGKAFNQKGALQTHMIKHTGEKPH
ACAFCPAAFSQKGNLQSHVQRVHSEVKNGPTYNCTECSCVFKSLGSLNTHISKMHMGGPQ
NSAGATETAHVLTATLFQTLPLQQTDTQVPSAPGQQSSQVVTDVIQQLLELSEPGPVEAS
QPPQAAQQLSITVGINQDILQQALENSGLSSIPVAAHPSDPSHTKAAAAQGQTPDATSVS
SEPADPTDTEQEKEQESPEKLDKKEKKIIKKKSPFLPGSIREENGVRWHVCPCCAKEFRK
PSDLVRHIRIHTHEKPFKCPQCFRAFAVKSTLTAHIKTHTGIKAFKCQYCMKSFSTSGSL
KVHIRLHTGVRPFACPHCDKKFRTSGHRKTHVASHFKHTELRKMRHQRKPAKVRVGKANV
PVPDIPLQEPILITDVGLIQPIPRNQLFQSYFNNNFVNEADRPYKCFYCHRAYKKSCHLK
QHIRSHTGEKPFKCSQCGRGFVSAGVLKAHVRTHTGLKSFKCLICNGAFTTGGSLRRHMG
IHNDLRPYMCPYCQKTFKTSLNCKKHMKTHRYELAQQLQQHQQASSMDDSTVDQQGMHVS
TPMQVEIESEALQPSTEAVAANPGAMLELGPPHGVSAEEAGLGPQMAGQPLEAEEDRFVA
PQQALQGHMDQLHEQAPPQQSFEPAGLSQGFTVTDTYSQQTPFPPVQQLQDSSTLESQAL
STSFHQQNLLPVPGTDTINVTTRLIQESPQEEMDLPPPRPPFLEETEEQSRRSYRCDYCS
KGFKKSSHLKQHVRSHTGEKPYKCKLCGRGFVSSGVLKSHEKTHTGVKAFSCSVCSTAFT
TNGSLTRHMATHVSAKPYRCPFCEQGFRTTMHCKKHMKTHQTAASGGSAPGDADGGEMGL
EEEEDGSERSTSRKARPEVITFTEEETAQLAKIPPQESATVSEQVLVQSAAEKDRISEMK
DRQAELEAEPKHANCCSYCPKSFKKPSDLVRHVRIHTGEKPYRCEECGKSFTVKSTLDCH
VKTHTGQKLFSCHVCSNAFSTKGSLKVHMRLHTGAKPFKCPHCELRFRTSGRRKTHMQFH
YKPDPKKARKPVPRAAAEGPQPVSAAPAPSADPGVFIMNSPVLTGQLDQSLLQPGLLGQA
VLPASVSAGGDWTVSLTDGSLATLEGIQLQLAANLVGPNVQISGIDASTVNNITLQIDPS
VLQQTLQQGNLLAQQLTAEPGLAPQGSSLQTPESTVPASVVIQPIPGLSLQPTVTSANLT
IGPLSEQDSVLATSSSGTQDLSQVMTSQGLVSTSGGPHEITLTINNSSLSQVLAQAAGPA
AATSSGPPQEITLTISELNATAGSLPPTTPLSPSAVSAQSLVMSSSAVGAEASVTLTLAD
TQGLLSGGLDTVTLNIASQGQQFPALLTDPSLSGPGGAGSPQVILVSPPAQPSSACEEIT
YQVTDVSASLAPGGAPEKEARLHACLECGCSFASAGLLLQHSKAAHGRERIHVCPVCRKA
FKRATHLKEHMQTHQAGPSLSSQKPRVFKCDTCEKAFAKPSQLERHSRIHTGERPFHCTL
CEKAFNQKSALQVHMKKHTGERPYKCDYCVMGFTQKSNMKLHMKRAHSYAGAVPEPVGQQ
DHGAEALSHALHLDEVVPEPASEWQALANVF
Download sequence
Identical sequences F1N0E1
ENSBTAP00000023285 ENSBTAP00000023285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]