SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023566 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023566
Domain Number 1 Region: 774-880
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000393
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 2 Region: 1079-1188
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000641
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 3 Region: 960-1055
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000302
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023566   Gene: ENSBTAG00000017719   Transcript: ENSBTAT00000023566
Sequence length 2319
Comment pep:known chromosome:UMD3.1:21:43132861:43630707:1 gene:ENSBTAG00000017719 transcript:ENSBTAT00000023566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTMSVTLSPLRSQDLDPMATDASPMAINLTPTVEQGGGEEVMRGMDPDQQYEKPPPLHT
GADWKIVLHLPEIETWLRMTSERVRDLTYSVQQDSDSKHVDVHLVQLKDICEDISDHVEQ
IHALLETEFSLKLLSYSVNVIVDIHAVQLLWHQLRVSVLVLRERILQGLQDANGNYTRQT
DILQAFSEETKEGRLDALTEVDDSGQLTIKCSQNYLSLDCGITAFELSDYSPSEDLLGGL
GDMTSSQVKTKPFDSWSYSEMEKEFPELIRSVGLLSVAPDSVPSNFSEAVSEEASQVSLS
ADDTGRSEENNACTVEEQPGLMQGPSSSVEAPTNAVQPASEAVKQESDSSSQHGAKNPQP
LACENTTPKRSIRDCFNYNEDSPTQPTLPKRGFFLKDETVKNNLKGPSGKKQMVDLKPEM
SRSTPSLVDPPDRSKLCLVLQSSYPNSPSAASQSYECLHKMGDGNLENTVRSHIKEISSS
LGRLNDCHKEKLRLKKPHKTGEEMPPCQTPKQEPSSDKQAKNTRSATVPNAIPSSPSKAR
QRPEAESASTSSLEPCHQSSGNAKLPVQSETSSSPPFTQSSESSASSDSVTSLGPLLSEH
KGKSSYSSSPSHITRNGQVVEAWYGSDEYLALPSHLKQTEVLALKLENLTKLLPQKPRGE
TVQNIDDWELSEMNSDSEMYPTYHVKKKHTRLGRVSPSSSSDIASSLGESVESGPLSDLL
SDEELGMPLSGMKKYADEKSERVSSSEKNESHSAAKSALIQKLMQDIQHQDNYEAIWEKI
EGFVNKLDEFIQWLNEAMETTENWTPPKAETDSLKLYLETHLSFKLNVDSHCALKEAVEE
EGHQLLELIASHKAGLKDMLRMIASQWKELQRQIKRQHSWILRALDTIKAEILATDVSVE
GEEGTGSPKAEVQLCYLEAQRDAVEQMSLKLYSEQYTSSSKRKEEFADMSKVHSGGGNGL
LDFDSEYQELWDWLIDMESLVMDSHDLMMSEEQQQHLYKRYSVEMSIRDLKKTELLSKVE
ALKKGGVLLPNDLLEKVDSINEKWELLGKTLGEKVQDTMAGHSGSSPRDLLSPESGSLVR
QLEVRIKELKGWLRDTELFIFNSCLRQEKEGTMNAEKQLQYFKSLCREIKQRRRGVASIL
RLCQHLLDDRETCNLNADHQPMQLIIVNLERRWEAIVMQAVQWQTRLQKKMGKESEALNV
IDPGLMDLNGTSEDALEWDETDISNKLISLNEELNDLDQESQPAMPSLNLKETDSENPSY
EEEAGGHGASQFASSITAPSSPHVYQVYSLHNVELYEDSHIPFLKNNPKFTSMTQPSVLT
KSLSKDSSFSSTKSLPDLLGGSNLVKPCPCHGGDMSQNSGSESGIVSEGDTETTTNSEMC
LLNAVDGSPSNPDTEHLDPQMGDAVNVLKQKIKDEEERIKLPNSSQLPISPVGCVNGKVG
DLNSVTKHTPDCLGEELQGKHDVFTFYDYSYLQGSKLKLPMIMKQSQSEKAHVEDPLLHG
FYFDKKSCKSKHQATELQPDAPPHERILASAPHEMDRSSYKSGDVEKTFTGMQNARQLSL
LSHSSSIESLSPGGDLFALGIFKNGSDSLQRSTSLESWLTSYKSNEDLFSCHSSGDLSVS
SGSVGELSKRTLDLLNRLENIQSPSEQKIKRSVSDITLQSCSQKMSFPGQLSLDMASSIN
EDSPASLTELSSSDELSLCSEDIVLHKNKIPESNVSFRKRLPRSVADESDVNVSMIVNVS
CTSACTDDEDDSDLLSSSTLTLTEEELCVKDEDDDSSIATDDEIYEDCNVMSGLDYIKNE
LQTWIRPKLSLTRDKRRCNLSDEIKGNKDVSSSEMTNSSDTLNIETLLNGSIKHLSENNG
NSKNLPHTRELGTKGENKKNIFTVNKDPYVADMENGNIESIPESQKDKLNEISKESESFG
SAGKRISESEHCKCKPVMDGSDESDIAGKESVPQMARHVPKKCQSHHHFENQSAASTPTE
KSCPELPSETSVINGQDSNVLKSSSNNAPSMAGKPAGCCLAREQNETEENVAASDNVSCC
DCEPDIFHQKDAEDCSVHDFVKEIIGMASTALKCKSQPENEVTAPTSLTQIKEKVLEHSH
RPIQLRKGDFYSYLSLSSHDSDCGEVTNYIEEKSSTPLPTDMTDSGSEDKEDTEYFFEAC
VEEDPAEDKPCFSDVPPNEPADPTEAAVPLLAGAGSSRFSDTSLLASNADMVALSSPPKG
GDVGKEVDSLPEASNVHGESAEVTTPSRLGSEKESSENPGESARPEEHSASSAPSGVPRL
SSKAKQPKDKAAWHPSPTALTCEENLLNLQEERHRNMHR
Download sequence
Identical sequences F1N0Q2
NP_001179852.1.59421 NP_001179852.1.76553 XP_005222105.1.76553 XP_010815460.1.76553 XP_010815461.1.76553 ENSBTAP00000023566 ENSBTAP00000023566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]