SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023578 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023578
Domain Number 1 Region: 265-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000154
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number 2 Region: 901-953
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000482
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 737-783
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000367
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 4 Region: 400-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000137
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 958-1007
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000146
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 868-909
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000283
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 7 Region: 775-833
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000507
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000023578
Domain Number - Region: 307-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000512
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number - Region: 351-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0112
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 442-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0121
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number - Region: 11-35,106-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0337
Family Classic zinc finger, C2H2 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023578   Gene: ENSBTAG00000017731   Transcript: ENSBTAT00000023578
Sequence length 1237
Comment pep:known chromosome:UMD3.1:14:8166449:8304533:1 gene:ENSBTAG00000017731 transcript:ENSBTAT00000023578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLFLTENPAIFMCKCCNLFSPSQSELLSHVSEKHAEEGVNADEIIIPLRPLSTPEPTNP
GKPGDEFSVMKRKRGRPKGSTKKPSPEEELAERSALPGVDGVRAPEEGSSLECSKCCRKF
SNPRQLRKHICIIVLNLGEAEGDAGNESDLELEKKYKEDDREKAPKRPRAQRAEKIQKVC
SGKEAPQMSGAKKPIISVVLTAHEAIPGATKIVPVEAGPPETGATDPEATAADLAPRRGY
QEYAIQQTAYEQPMKSSRLGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHTKEKPYKCSQC
SYASAIKANLNVHLRKHTGEKFACDCCSFTCLSKGHLKVHVERVHKKIKQHCRFCKKKYS
DVKNLIKHIRDAHDPQDKPVQEALDELCLMTREGKRQLLYDCHICERKFKNELDRDRHML
VHGDKWPFACELCGHGATKYQALELHVRKHPFVYVCALCPKKFVSSIRLRAHIKEAHGAA
QETLVFTSSINQSFCLLEPGGDIQQEALGGQLQLAEEEFVFQGVNVPKEAASPGQARPAV
EPRAPAEVPASPVRLAAAQPNGTAPAPPPSELAASAMSPDLRPHAGLSSEFLMKSDPPTA
EAPAATPEKTGDTQQGGAAPIQGQDVAPLLSKAKGMEANSEAPGAKSPPAEGQKVAAFSC
DGPDPSRGLRSNPAQASDPPPGAGGREAALCQPASCTPAPEHRAGLTAFMKILDSLQKRR
MNTGLCERIRKVYGDLECEYCGKLFWYQVHFDMHVRTHTREHLYYCSQCHYSSITKNCLK
RHVIQKHSNILLKCPTDGCDYSTPDKYKLQAHLKVHTELDKRSYSCPVCEKSFSEDRLIK
SHIKTNHPEVSMSTISEVLGRRVQLKGLIGKRAMKCPYCDFYFMKNGSDLQRHIWAHEGV
KPFKCSLCEYATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHTADGKQF
KCTVCDYTAAQKPQLLRHMEQHASFKPFRCAHCHYSCNISGSLKRHYNRKHPNEEYSNVG
TGELAADALIQQGGLKCPVCSFVYGTKWEFNRHLKNKHGLKLVESEGDPKWEPATEAPEE
PSTQYLHIAEAEEDVQGTQAAVAALQDLRYTSESGDRLDPTAVNILQQIIELGTETHDAT
AVASVVAMAPGTVTVVKQVTDEEPSSNHTVMIQETLQQASVELAEQHHLVVSSDDVEGIE
TVTVYTQGGEASEFIVYVQEAVQPVEEQASGPPAPEL
Download sequence
Identical sequences F1N0I1
ENSBTAP00000023578 ENSBTAP00000023578 9913.ENSBTAP00000023578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]