SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023678 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023678
Domain Number 1 Region: 553-639
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000104
Family Calmodulin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023678   Gene: ENSBTAG00000017810   Transcript: ENSBTAT00000023678
Sequence length 640
Comment pep:known chromosome:UMD3.1:23:24588032:24627769:1 gene:ENSBTAG00000017810 transcript:ENSBTAT00000023678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSNPVHGLPFLPGTSFKDLTKTAFHRSQTLGYRNGYAVVRRPTVGIGGDRLQVNQLSQA
DLDELASKIPILTYGQARQAPPAAFVPAHVAFDKKVLKFDAYFQEDVPMSIEEHYRIRQV
HIYYYLEDDSMSVIEPVVENSGIPQGKLIKRQRLSKNDRGDHYHWKDLNRGINITIYGKT
FRIVDCDKFTQVFLESQGIELNPPEKMALDPYTELRKQPLRKYVTPTDFDQLKQFLTFDK
QVLRFYAIWDDTDSMFGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRMPKV
LVENAKNFPRCVLEISDKEVLEWYTAKDFIVGKPLTILGRTFFIYDCDPFTRQYYQEKFG
ISDLPRIDMSKKEPPPMKQELPPYNGFGLIEDSAQNCFALIPKAPQKDVIKMLMNENKVL
RYLATLESPFPEDKGRRFVLSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPGSSVE
NPVYYGPSDFFIGAVIEVFGHRFVILDTDDYVLKYMESNAAQYSPEALLSIQNHIRKQEA
PAPELDGQQAEEDPGVRDLEALIDTIQKQLKDRPCRDNIREAFQIYDKEASGYVDRETFF
KICGSYQLPVDDSLIKELIRMCSHGEDKIDYYNFVRAFSN
Download sequence
Identical sequences E1BKH1
ENSBTAP00000023678 9913.ENSBTAP00000023678 NP_001179173.1.59421 NP_001179173.1.76553 XP_010861319.1.44457 ENSBTAP00000023678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]