SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023710 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023710
Domain Number 1 Region: 40-101
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 224-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000386
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 366-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000779
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 175-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000413
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 5 Region: 398-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000227
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023710   Gene: ENSBTAG00000017836   Transcript: ENSBTAT00000023710
Sequence length 515
Comment pep:known chromosome:UMD3.1:23:28735960:28739682:1 gene:ENSBTAG00000017836 transcript:ENSBTAT00000023710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKVSDQPKPVEPVQKLLPQVDEEGLPKAWKGECWWKEWVKKPVTFEDVAVNFTQEEWK
CLDVSQRVLYQDVISETVRNLMSVDGIFLSNLDLIAKLEQEEKQWEADLCSPNGEGFHSG
GKKEESQEQSQSLGDEGTVDDKKASLAHRGLGPTSPPAGSPEKTPTLPESWARPAFTCHT
CGKCFSKRSSLYNHQLVHNSAQCGKSFQNPKDLSSGRRKQPRERPFRCSLCGKTYCDASG
LSRHRRVHLGYRPHACPFCGKCFRDQSELKRHQKTHQGQKLGAGNQKHIVRTPDTRAGLQ
GLATGNHAAVAATQGPTLKTKGPKTQPQLSIDRNQEPVTRTLAANMRATRLNTKSNSHPE
KPSRLKVFSCPHCPLTFSRKTRLSSHQKVHFTEQSNRCFHCGKSFTLFSGLIRHQQTHWK
QRVYCCPICDVCFGEKEDLLGHWGGYRSKGLFLGSPHKCWAILGQWLGFFPNASAVAGKE
MDLSPGSRPSGKGRKGEEKARRRKKAKAMKVLEGK
Download sequence
Identical sequences E1BIN7
ENSBTAP00000023710 ENSBTAP00000023710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]