SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023758 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023758
Domain Number 1 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 444-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 529-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.43e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 361-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 248-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 211-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000936
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 491-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000348
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 8 Region: 574-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000117
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 9 Region: 408-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000168
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 139-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000135
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000023758
Domain Number - Region: 81-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0266
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023758   Gene: ENSBTAG00000017872   Transcript: ENSBTAT00000023758
Sequence length 620
Comment pep:known chromosome:UMD3.1:18:64691262:64695901:1 gene:ENSBTAG00000017872 transcript:ENSBTAT00000023758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENFAHVAALGCWCEADNEEAPSEQIVCVEGVSEVRTPGSCPLIQKVHPCERSDPLLKD
IFHWAEHQGSCPAQNLDTRDPCGRGFLLSENFHQHQKPHSGNDPVQGDADEASCVKSCAV
YELGRPCTCRGKGMDMLDSSSLFQHQSTHSGLSPHRTAEFAESFAHKSSLSCHQGDSDEL
MFFSCTDDEKAFMNAFSLLDNQVTQAVEVQSFRCLPCGNLSNEKSTLIHHRKLHGGETSH
VCRECGKAFINLSHLKTHQKFHTGKRQYTCSECGKAFSRKDTLVQHQRVHTGERSYDCTE
CGKAYSRSSHLVQHQRIHTGERPYKCSECGKAFSRKDTLVQHQRFHTGERPYECSECGKF
FSQSSHLIEHWRIHTGARPYECIECGKFFSHNSSLIKHRRVHTGAKSYVCGKCGKAFGCK
DTLVQHQIIHTGARPYECSECGKAFSRKDTLVQHRKIHTGERPYECNDCGKFFSHSSNLI
VHQRIHTGAKPYECSECGKCFSHNSSLILHQRVHSGARPYVCSECGKAYISSSHLVQHKK
VHTGARPYKCSECGKFFSRNSSLILHQRVHTGEKPYVCNECGKAYSRSSHLVRHQKAHPG
EGPHECGSFGDPLAASLKLV
Download sequence
Identical sequences F1MVZ3
9913.ENSBTAP00000023758 ENSBTAP00000023758 ENSBTAP00000023758 XP_005219846.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]