SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023779 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023779
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-18
Family HkH motif-containing C2H2 finger 0.046
Further Details:      
 
Domain Number 2 Region: 54-78
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000366
Family CCCH zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023779   Gene: ENSBTAG00000017890   Transcript: ENSBTAT00000023779
Sequence length 170
Comment pep:known chromosome:UMD3.1:17:71015443:71038221:-1 gene:ENSBTAG00000017890 transcript:ENSBTAT00000023779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKLWYDMFRDAAAILLDEQNKRPCRKF
LLTGQCDFGSNCRFSHMSERDLQELSVQVEEERRAREWPLDVAELPEVCLEDWLEKRAKR
LSSAPSSRAEPVRATVFQYPVGWPPVQELPPSLRAPPPGGWPLQPSVQWG
Download sequence
Identical sequences L8J2C3 Q2TA39
ENSBTAP00000023779 NP_001033299.1.59421 NP_001033299.1.76553 XP_005218156.1.76553 XP_005887566.1.15283 XP_010827047.1.44457 XP_010827048.1.44457 ENSBTAP00000023779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]