SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000023928 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000023928
Domain Number 1 Region: 332-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.38e-18
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 2 Region: 375-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000166
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 284-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000186
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000023928   Gene: ENSBTAG00000017986   Transcript: ENSBTAT00000023928
Sequence length 709
Comment pep:known chromosome:UMD3.1:3:93208981:93308964:1 gene:ENSBTAG00000017986 transcript:ENSBTAT00000023928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNGSYGHCTPGSEKSLLDLDLAEGPGPTCRQGLFLPAGSPPPRGHPLACERLLHFPHPSR
SPRPQATYVNGGLPATQHIKQESLPDYRAMTEARAPPSAHCRAPPATGLHTDLDLPGRGL
ANPAPSCYLLGSEPSSGLGPPPEAHLPEGGLKRCCLLGLPPTSSVSVSPCAASDITSIIR
SSQTALVTCVNGLRSPPMPGDTGGPPKRARPSSASTESHEGTLRLEACRKAGFLKQEPAD
EFSELFGPHQQGLPPPYPLSQLPPGPGLGGLGLGLAGRGLAGRQACRWVDCCAAYEQQEE
LVRHIEKSHIDQRKGEDFTCFWAGCVRRYKPFNARYKLLIHMRVHSGEKPNKCMFEGCSK
AFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCSK
RYTDPSSLRKHVKAHSAKEQQVRKKLHTGPDAEADILTECLALQQLHTSTQLAASDGKGG
RALGQELLPGMYPGSINPHNGLAASILPSMHDVPSRHHPLDATTSSHHHLSPLPTAESTR
DGLGPGLLSPMVSPLKGLGPPPLPPSSQSHSPGGQPFPTLPSKPPYPPFQSPPPQPLPSP
QGYQGSFHSIQNCFPYGDCYRSAEQAASGDGLAGEAHGFNPLRPNGYHGLSAPLPAPGYE
ALAEAPCPTTMPPQSSEDVVSSGPEDCGFFPNGAFDHCLSHIPSIYTDT
Download sequence
Identical sequences F1MXG5
ENSBTAP00000023928 ENSBTAP00000023928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]