SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024037 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024037
Domain Number 1 Region: 410-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 354-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-22
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 4 Region: 3-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.67e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 5 Region: 242-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.19e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 723-776
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.26e-21
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 7 Region: 776-829
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.07e-21
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 8 Region: 664-718
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-19
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 9 Region: 583-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 10 Region: 523-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.37e-18
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 11 Region: 466-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.15e-18
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 12 Region: 206-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000334
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024037   Gene: ENSBTAG00000018057   Transcript: ENSBTAT00000024037
Sequence length 844
Comment pep:known chromosome:UMD3.1:22:13368973:13380344:1 gene:ENSBTAG00000018057 transcript:ENSBTAT00000024037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLLFQEPVTFEDVAVYFTQNQWASLDSAQRALYREVMLENYPNITSLTAFPFPKPDLIFW
LERGEEPGRLDPWTLRETVAEEWTFYKSLNTKLGSSFYLVDSLSHLVAPVLKLPQFLMLF
RTSFLRILNCVFKILGCNSLGLNQPCLFSIRGTISILVCQVGSGPRGGTDLETEFGCKDL
LQPQLHLHLFNSLEKLQLYDPEQVFYNCGECGRYFNQHSDLHQHQRIHMDKKPYKCKERG
KAFRYNSKLSRHQKIHIGEKPYSCQECGQAFNQNSHLLQHQKLHGGEKPYECKDCGKTFS
YNSKLIWHQRIHTGEKPFKCKECGKAFKCNYDRVIHERIHTGEKPYECKECGKSFSSNSV
LIQHQRIHTGEKPYKCKECSKAFHRSSLFLQHQRFHTGEKLYKCNECWKTFSCSSRFIVH
QRIHTGEKPYECQECGKAFNQKITLVQHQRVHTGEKPYECKVCGKSFRWSTSFIHHQKLH
TSGMKFYKCKECGKIFRYNSQLLRHQSRHTGEKPFKCKECGKAFKSSQNCIVHEKNHIGK
GPYECKECGKGLSSKTALTQHQRIHTGEKLYKCKECGKGLSSNTALTQHQRLHTGEKLYK
CKECGKAFTQKITSIQHQRVHTGEKPYECKEYTQLLEENTILNPNLILRGGMKFYKCKEC
GKIFRYNSKLLRHQRSHTGEKPFKCKECGKAFKSSYDCIVHEKNHIGQGPYECKECGKGL
SSNTALTQHQRIHTGEKPYACKECGKAFRRSAAYLQHQRLHTGEKLYKCKECWKGFGCRS
LFIVHQRIHTGEKPYQCKECGKAFSQKIASIQHQRVHTGEKPYECKVWKVLFGFFSPCTP
GHSS
Download sequence
Identical sequences E1BFD8
ENSBTAP00000024037 ENSBTAP00000024707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]