SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024083 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024083
Domain Number 1 Region: 26-73
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-18
Family KRAB domain (Kruppel-associated box) 0.0025
Further Details:      
 
Domain Number 2 Region: 143-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000318
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024083   Gene: ENSBTAG00000019357   Transcript: ENSBTAT00000024083
Sequence length 238
Comment pep:known chromosome:UMD3.1:25:26993387:26996169:-1 gene:ENSBTAG00000019357 transcript:ENSBTAT00000024083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPPAPLLVLRPGETGPGCKKPLAVRFADVAVYFSPEEWGCLRPAQRALYRDVMQETYG
HLGALGATPNKKEEEPEAGLGAKSPRKAPGKERPEELVKHNPGTTVSKTSARAQAPRQAV
WDQGAGAQSPAPVPSADAQASQRRHVCADCGRRFTYPSLLVSHRRMHSGERPFPCPECGM
RFKRKFAVEAHQWIHRSCSGGRRGRRPGIRAVPRAPVRGDRDPPVLFRHYPDIFEECG
Download sequence
Identical sequences F1MHA2
ENSBTAP00000024083 XP_005888868.1.15283 ENSBTAP00000024083 9913.ENSBTAP00000024083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]