SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024312 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024312
Domain Number 1 Region: 119-179
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000366
Family B-box zinc-binding domain 0.00013
Further Details:      
 
Domain Number 2 Region: 18-111
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000104
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000024312
Domain Number - Region: 181-238
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0206
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024312   Gene: ENSBTAG00000018267   Transcript: ENSBTAT00000024312
Sequence length 366
Comment pep:known chromosome:UMD3.1:11:72327351:72348528:-1 gene:ENSBTAG00000018267 transcript:ENSBTAT00000024312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQASNP
LWQSRSSTTVSSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESSRPLHSKA
EQHLMCEEHEDEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYKRQKSELSDGIAM
LVAGNDRVQAVITQMEEVCQTIEENSRRQKQLLNQRFEGLCAVLEERKGELLQALAREQE
EKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYLQQAKELINKVGTMSKVELAG
RPEPGYERMDQFTVSVEHVAEMLRTIDFQPGTSGEEEDEEVAVEGEEGNAGPEEERTDGR
ESTGQH
Download sequence
Identical sequences Q58D15
ENSBTAP00000024312 ENSBTAP00000024312 NP_001017951.1.59421 NP_001017951.1.76553 XP_006046242.1.26621 XP_019826096.1.53367 9913.ENSBTAP00000024312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]