SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024395 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024395
Domain Number 1 Region: 59-117
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000225
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 197-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000163
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 104-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000294
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 138-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000328
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024395   Gene: ENSBTAG00000018334   Transcript: ENSBTAT00000024395
Sequence length 506
Comment pep:known chromosome:UMD3.1:13:62226994:62236866:-1 gene:ENSBTAG00000018334 transcript:ENSBTAT00000024395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITWPFAISLAMTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAENQVKCQCEISGTPFS
NGEKLRPHSLPHPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQCMYCDKMFHRK
DHLRNHLQTHDPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQTFESTQA
LLEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDVRRHLVVHTGRKDFLCQYCAQRFGR
KDHLTRHVKKSHSQELLKIKTEPVDMLGLLSCSSTVNVKEELSPVLCMASRDVMGAKAFP
GMLPMGMYGAHIPTMPSAGVPHSLVHNTLPMGMSYPLESSPISSPAQLPPKYQLGSTSYL
PDKLPKVEVDSFLGELSGSLSLSSAEPQPTSPQPAAAAALLDEALLTKSPANLSEALCAA
NVDFSHLLGFLPLNLPPCNPSGATGGLVMGYSQAEAQPLLTTLQAQPQDSPGAGGPLNFG
PLHSLPPVFTSGLSTTTLPRFHQAFQ
Download sequence
Identical sequences F1MFV9
ENSBTAP00000024395 ENSBTAP00000024395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]