SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000024709 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000024709
Domain Number 1 Region: 50-160
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.19e-38
Family Frizzled cysteine-rich domain 0.0000587
Further Details:      
 
Domain Number 2 Region: 177-305
Classification Level Classification E-value
Superfamily TIMP-like 7.06e-24
Family Tissue inhibitor of metalloproteinases, TIMP 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000024709   Gene: ENSBTAG00000018566   Transcript: ENSBTAT00000024709
Sequence length 315
Comment pep:known chromosome:UMD3.1:26:18782564:18787376:-1 gene:ENSBTAG00000018566 transcript:ENSBTAT00000024709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAAAGGARAAVLALLLGALHGAPARGEEYDYYGWQTEPLHGRSYSKPPQCLDIPADLPL
CHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIY
PCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKICA
QCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKSGPLKRKDTKR
LVLHMKNSAGCPCPQLDSLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFSYP
CSLYYPFFYGAAEPH
Download sequence
Identical sequences Q9XSC1
ENSBTAP00000024709 NP_776886.1.59421 NP_776886.1.76553 XP_019808732.1.53367 ENSBTAP00000024709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]