SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025205 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025205
Domain Number 1 Region: 47-118
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000215
Family Calmodulin-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025205   Gene: ENSBTAG00000018940   Transcript: ENSBTAT00000025205
Sequence length 368
Comment pep:known chromosome:UMD3.1:5:106719233:106762334:1 gene:ENSBTAG00000018940 transcript:ENSBTAT00000025205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIDGRMVSRPRGSGRGRQGSGACLGSLDDLPCEGTQELAATQLAMLRRAQEFFQTCDK
EGKGFIARADMQRLHKELPLSLEDLEDVFDTLDADGNGFLTPEEFTTGFSHFFFSQNNPS
QEDAGAQPAQLQEEKVYQSRGDEDLGDMDEDEEAQFQTLMDRLGAQKVLEDEADVKQLWL
QLKKDEPHLLSNFEDFLTRIFSQLLEAHEEKNELECALKKKIAAYDEEIQHLYEEMEQQI
KTEKEQFLLKDTERFRARSQELERKLLSKEQELEQLVQKQKRLEGQCTALHNDKHETKAE
NTKLRLTNQELARELERTSRELQDAQQQLESLRQEAHKLHQEKEMEVYRVTESLQREKSG
LLKQLDFL
Download sequence
Identical sequences E1BER4
ENSBTAP00000025205 ENSBTAP00000025205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]