SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025237 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025237
Domain Number 1 Region: 216-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 272-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 356-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 445-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-23
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 525-572
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-20
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 178-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.91e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 403-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000609
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 8 Region: 319-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000284
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 9 Region: 487-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000241
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025237   Gene: ENSBTAG00000018960   Transcript: ENSBTAT00000025237
Sequence length 573
Comment pep:known chromosome:UMD3.1:28:12923499:12925584:1 gene:ENSBTAG00000018960 transcript:ENSBTAT00000025237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVWKTDHMKERSHENQPKHVWEVVLINNKRLTKEQGNVLGKSLELDTDSFPYRKILCQCV
SCGMSFNYISELVIDKKNSLGKKTDEFNACGKLLLSIKHEKTHTREKNEYFKSGKIVSHK
EDSVQLEKIQTLEQNFEYNIHQESFNEKVVLNTYKTEITEENDCAYDEYLQKTQKGEKHF
ECNECGKAFWEKSHLTRHQRIHTGEKNFQCNECGKTFWEKSNLTKHQRSHTGEKPYECSE
CGKAFSHKSALTLHQRTHTGEKPYQCNACGKTFYQKSDLTKHQRTHTGLKPYECYECGKS
FCMNSHLTVHQRTHTGEKPFECPECGKSFCQKSHLTQHQITHIGDKPYECNACGKTFYHK
SVLTRHQRTHTGEKPFACPECGKFFSHKSTLSQHYRIHTGEKPYECHECGKIFYNKSYLT
KHNRTHTGEKPYECNECGKSLLPESALIVHQRTHIEEKPYKCNECGKSFCVKSGLTLHQR
KHTGEKPYECNECGKSFSHKSSLTVHHRAHTGEKSCQCNECGKIFYRKSDLAKHQRSHTG
EKPYECNTCQKTFSQKSNLIVHQRTHIGEKPYN
Download sequence
Identical sequences F1MTF5
ENSBTAP00000025237 ENSBTAP00000025237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]