SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025240 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025240
Domain Number 1 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 3-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.67e-25
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 517-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 335-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000447
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 434-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000732
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 268-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000129
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 8 Region: 230-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000331
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025240   Gene: ENSBTAG00000013592   Transcript: ENSBTAT00000025240
Sequence length 578
Comment pep:known chromosome:UMD3.1:28:13223728:13246045:1 gene:ENSBTAG00000013592 transcript:ENSBTAT00000025240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKSQEQVSFKDVCVDFTQEEWYLLDPAQKILYRDVILENYSHLVSVGNCITKPEVIFKI
EQGEEPWILEERFPKQWHSEDWKVDDLIDSTQENQDEHFWQLAFTSNKTLSTDSGDRVKK
TLNLGTDSIPSSNFLYKICDSCEVSLKNISGLIINRKNYSGKKPDEFNVYEKLLLDIGHD
KAPLGGKSYKYNQKKNVLNHGQDLTQSIFDQPFEYNENGRGNHGEAAFFTNKKVQIGETH
CKYNECGRNFIQSLKLSLSQRTLFEMEPCECSICGKSFYMDLRFGHQRALMGDSPYEYNE
YGQIFCGNSTFVIHQGTYTGKIPHEYKVSHKTWEKSALFKHQIVHMGGKPYEHNENGNTF
NKKSHLTQLRRAHSGEKTFVCGECGKTFWEKSNLTQHQRTHTGEKPYECTECGKSFCQKP
HLTNHQRTHTGEKPYECKQCGKTFCVKSNLTEHQRTHTGEKPYECNACGKSFCHRSALTV
HQRTHTGEKPFICNECGKSFCVKSNLIVHQRTHTGEKPYKCNECGKTFCEKSALTKHQRT
HTGEKPYECNGCGKTFSQRSVLTKHQRIHTRVKALSAS
Download sequence
Identical sequences F1MTF3
NP_001178411.1.59421 NP_001178411.1.76553 XP_005226318.1.76553 XP_015316434.1.76553 ENSBTAP00000025240 ENSBTAP00000025240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]