SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025254 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025254
Domain Number 1 Region: 121-359,402-480,525-618
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.83e-124
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000266
Further Details:      
 
Domain Number 2 Region: 602-725
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.87e-31
Family Anticodon-binding domain of Class II aaRS 0.00025
Further Details:      
 
Domain Number 3 Region: 70-103
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00000549
Family a tRNA synthase domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025254   Gene: ENSBTAG00000018972   Transcript: ENSBTAT00000025254
Sequence length 739
Comment pep:known chromosome:UMD3.1:4:66102956:66156434:-1 gene:ENSBTAG00000018972 transcript:ENSBTAT00000025254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLRPALLRAARAALLPSPPPGLPARPPLLPCRPISKPARVPTWFPAAASRSSMDGAGA
EEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRILEAKELALQPKDDVVD
RAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDC
TMLTPEPVLKTSGHVDKFADFMVKDLKNGECFRADHLLKAHLQKLMSDKKCSAEKKSEME
SVLAQLDNYGQQELADLFVNYNVKSPTTGNDLSPPVPFNLMFKTFIGPGGNMPGYLRPET
AQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEK
DHPKFQNVADLYLYLYSAKAQVSGQSARKMRLGDAVEQGVINNSVLGYFIGRIYLYLVKV
GVSPEKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPL
VAEKPLKEPKTVNVVQFEPNKGAIGKAYKKDAKLVMEYLAICDECYITEMEKLLNEKGEF
TVETEGKTFQLTKDMVNVKRFQKTLHVEEVIPSVIEPSFGLGRIMYTVFEHTFQVREGDE
QRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGISHKVDDSSGSIGRRYAR
TDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVRDLANGSIMWADVE
ARYPVFEGQETGKKEAIEE
Download sequence
Identical sequences A5D7A2
NP_001091035.1.59421 NP_001091035.1.76553 ENSBTAP00000025254 ENSBTAP00000025254 9913.ENSBTAP00000025254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]