SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025295 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025295
Domain Number 1 Region: 639-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000109
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 2 Region: 559-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000284
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 3 Region: 597-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000533
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 4 Region: 528-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000319
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 5 Region: 219-334
Classification Level Classification E-value
Superfamily SET domain 0.000048
Family Histone lysine methyltransferases 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025295   Gene: ENSBTAG00000019001   Transcript: ENSBTAT00000025295
Sequence length 1154
Comment pep:known chromosome:UMD3.1:29:36684172:36749050:-1 gene:ENSBTAG00000019001 transcript:ENSBTAT00000025295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKDEGSHVWPPAAEHEENAAQVHFVPDAGTVAQIVYTDDQVRPPQQVVYTADGASYAS
VDGPQHTLVYIHPVEAAQTLFTDPGQVAYVQQDATAQQASLPVHNQVLPSIESVDGSDPL
ATLQNPMARLEAKEEEDEDEDEDSEDEEEEDGEDTDLDDWEPDPPRPFDPHDLWCEECNN
AHSSVCPKHGPLHPIPNRPVLTRARASLPLVLYIDRFLGGVFSKRRIPKRTQFGPVEGPL
VRESELKDCYIHLKVSLDKGDRKDRDLHEDLWFELSDETLCNWMMFVRPAQNHLEQNLVA
YQYGHHVYYTTIKNVEPKQELKVWYAASYAEFVNRKIHDISEEERKVLREQEKNWPCYEC
NRRFISSEQLQQHLNSHDEKLDVFSRARGRGRGRGKRRFGPGRRPGRPPKFIRLEITSEN
GEKCDDGTQDLLHFSTKEQFDEAEAATPNGLDQPEQPTLPLPQLPPEAPSSLEQEPDTHE
LHLQPQHEESVLPAQSTLTADDMRRAKRIRLELQNAALQHLFIRKSFRPFKCLHCGKAFR
EKDKLDQHVRFHGREGNCPLTCDLCNKGFISSASLESHMKLHSDQKTYSCIFCPESFDRL
DLLKDHVAIHINDGYFSCPTCKKRFPDFIQVKKHVRSFHSEKIYQCTECDKAFCRPDKLR
LHMLRHSDRKDFLCSTCGKQFKRKDKLREHMQRMHNPEREAKKADRSSRSKTFKPRITST
DYDSFTFKCRLCMMGFRRRGMLVNHLSKRHPDMKIEEVPELTLPIIKPNRDYFCQYCDKV
YKSASKRKAHILKNHPGAELPPSIRKLRPAGPGEPDPMLSTHTQLTGTIATPPVCCPHCS
KQYSSKTKMVQHIRKKHPEYAQLPNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLT
QAMTELSQTLTTDYRTPQGDYQRIQYIPVSQSTSGLQQPQHIQLQVVQVAPATSPHQSQQ
STVDVAQLHDPQTYTQHAIQVQHIQVTEPPAPAMSTSQVAGQPLSPSPQQSQQGLSPPHV
AGSSSQGQALQQPPQGSTVQHTYLPNTWNSFRGYSSEIQMMTLPPGQFVITDSGVATPVT
TGQVKAVTPGHYVLSESQSELEEKQASALSGGVQVQPAAHSDLDPQTTSQQPTQYIITTT
TNGNGSSEVHITKP
Download sequence
Identical sequences E1BE45
ENSBTAP00000025295 ENSBTAP00000025295 NP_001178097.1.59421 NP_001178097.1.76553 XP_005226898.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]