SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025469 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000025469
Domain Number - Region: 307-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0496
Family Classic zinc finger, C2H2 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025469   Gene: ENSBTAG00000019133   Transcript: ENSBTAT00000025469
Sequence length 579
Comment pep:known chromosome:UMD3.1:3:53385189:53419460:-1 gene:ENSBTAG00000019133 transcript:ENSBTAT00000025469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFEDDYTHSACRNTYQSFNGMDRDYGPGSYGGMDRDYGHGSYGGQRSMDSYLNQSYGMD
NHSGGGGGSRFGPYESYDSRSSLGGRDLYRSGYGFNEPEQSRFGGSYGGRFESSYRNSLD
SFGGRNQGGSSWEAPYSRSKLRPGFMEDRGRENYSSYSSFSSPHMKPAPVGSRGRGTPAY
PESTFGSRNYDAFGGPSTGRGRGRGHMSDFGSIHRPGIVVDYQNKPTNVTVAAARGIKRK
MIQPFNKPGGTFIKKPKLAKPVEKMSLSKSPTKTDPKNEEEEKRRIEARREKQRRRREKN
SEKYGDGYRMAFTCSFCKFRTFEEKDIELHLESASHQETLDHIQKQTKFDKVVMEFLHEC
MVNKFKKTSIRKQQTNNQTEAVKIIEKDVMEGVTADDHMMKVETVHCSACSVYIPALHSS
VQQHLKSPDHIKGKQAYKEQIKRESVLTATSILNNPIVKARYERFIKGENPFEIQDHSQD
QQIEGDEEEEEKIDEPVEEEEEEEEEEEEVGEVEEAEEVGEGGGVEGVGDTEEGGDVEGE
GEVGAVGEGEGEGEGVGEVEEEEAKEEPVGFSVDQAEEN
Download sequence
Identical sequences F1MJM0
ENSBTAP00000025469 ENSBTAP00000025469 9913.ENSBTAP00000025469 NP_001192957.1.59421 NP_001192957.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]