SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025518 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025518
Domain Number 1 Region: 500-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 332-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 443-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000316
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 541-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000392
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 293-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000126
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 6 Region: 388-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000798
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025518   Gene: ENSBTAG00000019174   Transcript: ENSBTAT00000025518
Sequence length 664
Comment pep:known chromosome:UMD3.1:21:21888268:21899698:1 gene:ENSBTAG00000019174 transcript:ENSBTAT00000025518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGFMDSGTQTDAVVVLSLAQAAVLGLVSENELFGATISAEAFYPDLGPELSGAAIGEPR
PPGPDVYQLACHGRALEEPAEEEVLEVEAAFEKHTRRKTRPPVRLVPKVKFEKVEEEEEV
YEVSVPGGDDKDAGPAEAPAEAAGGGCEALVQSSAVKMIDLSVFSRKPRTLRHLPRAPRP
ELDVAPFDPHFPDPARDAFAEPSMALPRPEALPVECGFEPPHLPPLSDPEPPTMESPEPV
KPEQGFVWQEVGEFEADAAGSTVERHKKAQLDRLDINVQIDDSYLVEAGDRQKRWQCRMC
EKSYTSKYNLVTHILGHNGIKPHSCPHCSKLFKQPSHLQTHLLTHQGTRPHKCQVCQKAF
TQTSHLKRHMLLHSEVKPYSCHFCGRGFAYPSELKAHEVKHESGRCHVCVECGLDFSTLT
QLKRHLASHQGPTLYQCLECDKSFHYRSQLQNHMLKHQNVRPFVCTECGMEFSQIHHLKQ
HSLTHKGVKEFKCEVCGREFTLQANMKRHMLIHTSVRPYQCHICFKTFVQKQTLKTHMIV
HSPVKPFKCKVCGKSFNRMYNLLGHMHLHAGSKPFKCPYCSSKFNLKGNLSRHMKVKHGV
MDIGLDSQDPMMELTGTDPSELDSQQEMEDFEENAYAYAGVDGSAEASVLSEQAMKEMAY
YNVL
Download sequence
Identical sequences G5E5M3
ENSBTAP00000025518 9913.ENSBTAP00000025518 ENSBTAP00000025518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]