SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025536 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025536
Domain Number 1 Region: 1868-1942
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-36
Family Classic zinc finger, C2H2 0.0000354
Further Details:      
 
Domain Number 2 Region: 2029-2085
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000895
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 3 Region: 2296-2344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000182
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 4 Region: 538-592
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000288
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025536   Gene: ENSBTAG00000019187   Transcript: ENSBTAT00000025536
Sequence length 2502
Comment pep:known chromosome:UMD3.1:8:98331864:98426787:1 gene:ENSBTAG00000019187 transcript:ENSBTAT00000025536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVLQCDGCDFRAPSYEDLKAHIQDVHTAFLQPTDVAEDNANESRSGSMNASNQTEVEFS
SIKDEFAIAEDLTGQNAAALGTGSYYGHSPGYYSQHIAPNPKPTNKFFQCKFCVRYFRSK
NLLIEHTRKVHGAQAEGSSAGPPVPGSLNYNIMMHEGFGKVFSCQFCTYKSPRRARIIKH
QKMYHKNNLKETTAPPPAPAPMPDPVVPPMSLQDPCKELPAEVVERSILESMVKPLTKSR
GNFCCEWCSYQTPRRERWCDHMMKKHRSMVKILSSLRQQQEGTNVPEAQNKNDLSPTSNS
TYLSMNAASRELPNTNVSNFRGSIGNSIMRPNSSSTSKFSPMSYPQMKPKSPHNSGLVNL
AERSRYGMPDMTNSADLDTNSMLNDSSSDEELNEIDSENGLNAMDHQTVGMSAEQLMGSE
GNKLLETKGIPFRRFMNRFQCPFCPFLTMHRRSISRHIENIHLSGKTAVYKCDECPFTCK
SSLKLGAHKQCHTGTTSDWDAVNSQSEGISSSLNEGVVSYESSSINGRKSGVLLDPLQQQ
QPPPPPPPPPPPPPSQPQPPQLQSPHQVPPQPQLPPPPPPPPAQAPPLHPYKCTMCNYST
TTLKGLRVHQQHKHSFCDNLPKFEGQTSSLPLDSETDSHPSSSNTVKKSQTSILGLSSKN
NFVAKASRKLANDFPLDLSPVKKRTRIDEIASNLQSKINQTKQQEDAVINVEDDEEEEED
NEVEIEVELDREEEPPEPILEVPTPFSAQQIWARDAPEPPKEPNFRTVAHDYNATNGAEI
ELTLSEDEEDYYGSSTNMKDHQVSNTTLLNTQTPIYASEHNNENTDFSDSGRLYYCKHCD
FNNKSARSVSTHYQRMHPYIKFSFRYILDPNDHSAVYRCLECYIDYTNFEDLQQHYGEHH
PEAMNVLNFDHSDLIYRCRFCSYTSPNVRSLMPHYQRMHPTVKINNAMIFSSYVVEQQEG
LGTESQTLREILNSAPKNMATSTPMARGGGMPAPYPKNTPSKTFPPECENQKDPSVNTVV
VYDCDVCSFASPNMHSVLVHYQKKHPEEKASYFRIQKTMRMVSVDRGSALSQLSFEVGAP
MSPKMSTMGSPPPPQPPPPDLSTELYYCKHCSYSNRSVVGVLVHYQKRHPEIKVTAKYIR
QAPPTAAMMRGPEGPHGSPRPPAPMQQLNRSSSERDGPPVENEMFFCQHCDYGNRTVKGV
LIHYQKKHRDFKANADVIRQHTATIRSLCDRNQKKPASCMLVSPSGVERDKTKLRALKCR
QCSYTSPYFYALRKHIKKDHPALKATVTSIMRWAFLDGLIEAGYHCEWCIYSHTEPSGLL
LHYQRRHPEHYVDYTYMATKLWAGPDPSPPSLTMPAEAKTYRCRDCVFEALSIWDITNHY
QAFHPWAMNGDESVLLDIIKEKDAVENPMSSSEDLVGTVSCENSMPGPLAEQEGECPEDA
RLSPEKTIQLASVNPAISSTPYQCTVCQSEYNNLHGLLTHYGKKHPGMKVKAADFAQDID
INPGAVYKCRHCPYINTRIHGVLTHYQKRHPSIKVTAEDFVHDVEQSTDIAQNDVEETSR
IFKQGYGAYRCKLCPYTHGTLEKLKIHYEKYHNQPEFDVFSQSPPKLPMSLEPEITTEVS
PSQVSVTEDEVGEEPVSTSHFATSHLVSHTVFRCQLCKYFCSTRKGIARHYRIKHNNVRA
QPEGKNNLFKCALCAYTNPIRKGLAAHYQKRHDIDAYYTHCLAASRTISDKPNKVIIPSP
PKDDSPPLSEELRRAVEKKKCSLCAFQSFSKKGIVSHYMKRHPGVFPKKQHASKLGGYFT
AVYADEHEKPVLMEDSEERGGFEKAEVEGNEGQDIEWLPFRCIKCFKLSFSTAELLSMHY
TDHHSRDLKRDFVILGGGPRLQGSAYQCKHCESRLQSTAELTSHLNIHNEEFQKRAKRQE
RRKQLLSKQKYADGAFADFKQERPFGHLEEVPKIKERKVVGYKCKFCVEVHPTLRAICNH
LRKHVQYGSVPAVSAAVKGLRSHERSHLALAMFTREDKYSCQYCSFVSAFRHKSSLDRHM
QTHHGHHKPFRCKLCSFKSSYNSRLKTHVLKAHAGEHAYKCSWCSFSTMTISQLKEHSLK
VHGKALTLPRPRIVSLLSSHAHHSSQKATPAEEVEDSNDSSYSEPPDVQQQLNHYQSAAL
ARNNSRVSPVPLSGAAGGAEQKTEAILHCEFCEFSSGYIQSIRRHYRDKHGGKKLFKCKD
CSFYTGFKSAFTMHVEAGHSAVPEEGPKDLRCPLCLYHTKYKRNMIDHIVLHREERVVPI
EVCRSKLSKYLQGVVFRCDKCTFTCSSDESLQQHIEKHNELKPYKCQLCYYETKHTEELD
SHLRDEHKVSRNFELVGRVNLDQLEQMKEKMESSSSDDEDKEEEMNSKADDRDLLRFSDR
GAAINTEKRFPCEFCGRAFSQGSEWERHVLRHGMALNDTKQVSREEIHLKGNMEDSIKMP
SIEEKEDDETIGIDFSLKNEPVAICVVAADKSLLENAEAKKE
Download sequence
Identical sequences F1MIB3
ENSBTAP00000025536 ENSBTAP00000025536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]