SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025537 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025537
Domain Number 1 Region: 39-322
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.77e-64
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 1103-1267
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.19e-43
Family Chaperone J-domain 0.000000603
Further Details:      
 
Domain Number 3 Region: 396-550
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.7e-27
Family Dual specificity phosphatase-like 0.00013
Further Details:      
 
Domain Number 4 Region: 560-697
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.18e-17
Family PLC-like (P variant) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025537   Gene: ENSBTAG00000019188   Transcript: ENSBTAT00000025537
Sequence length 1268
Comment pep:known chromosome:UMD3.1:6:108988692:109036271:-1 gene:ENSBTAG00000019188 transcript:ENSBTAT00000025537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLQSALDFLAGPGSLGGAAGRDQTDFVGQTVEMGELRLRVRRVLAEGGFAFVYEAQDL
GSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFL
LLMELCRGQLVEFLKKVESKGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLL
LSNQGTIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIVDLYSNFPI
GEKQDIWALGCILYLLCFGQHPFEDGAKLRIVNGKYAIPADDTRYSVFHSLIRSMLKVNP
EERLSVTELVNQLQEIAAARNVNPKSPITELLEQNGGYGHAAPPGSTGSSLVVTEYEQPY
GGFLDILRGGTERLFTNIKDTSSKVIQSVANYAKGDLDISYITSRIAVMSFPAEGVESAI
KNNIEDVRLFLDSKHPGRYAVYNLSPRTYRPSKFHNRVSDCGWVARRAPSLRSLYSLCRN
MHAWLRRDPGNVCVVHCMDGRAVSAVAVCSFLCFCRLFSTAEAAVYMFSMKRCPPGIWPS
HKRYIEYMCDMVAEEPVTPHSKPILVKAVVMTPVPLFSKQRSGCRPFCEVYVGDERVTTT
SQEYDKMRDFKIEDGKAVIPLGITVQGDVLIIIYHARSTLGGRLQAKMASMKMFQIQFHT
GFVPRNAATVKFAKYDLDACDIQEKYPDLFQVSLEVEVEPRDRPGHEAPPWEGAGMRGLN
PKILFSSREEQQDVLSKFGKPELPRQPGSTAQYDAEAGPADAEPPESDSPHSSVDADHFL
HTLDWREDRDSSVGPEGHLAEEGPSAVAEDGCVSEPSDEEAPTPSAESGDTGDEDVPAPA
APQDDSVDLLGLHAEAGPVPAPQAPGGPPSNADLLGCLLGAPGPAPEGAVGGLLDGDAAL
LFSSPAPAPCTQTTAPAADPFGPLLLPPDVDTPPSSQPDLFGEFLNSDAPAAQPAPFPST
HSAPPPACSTDFLHLGDLPAEPSKMTASASHPDLLGAWDAWAEAPAPALAADGTFFSPGD
QPAPSGLPAGQTKSQSQDPFADLGDLSAGLQGSPAAAAPGGFGPKAAPPPKASSSWQTSR
PPAQGTPWPPQAKPPPKASVPPRPNYTSSFSVIGSREERGVRAPSFGPKPRVSENDFEDL
LSNQGFSSRADRKGPRTIAEMRRQDQARDLDPLKLKLLEWTEGKERNIRALLSTLHTALW
DGESRWTPVGMADLVTPAQVKKHYRRAVLVVHPDKARGQPYEQYARMIFMELNDAWAEFE
SQGSRPLF
Download sequence
Identical sequences F1MIB2
ENSBTAP00000025537 ENSBTAP00000025537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]