SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025840 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025840
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.28e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 206-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 150-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 263-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.49e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 308-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.22e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 116-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000782
Family Classic zinc finger, C2H2 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025840   Gene: ENSBTAG00000037906   Transcript: ENSBTAT00000025840
Sequence length 461
Comment pep:known chromosome:UMD3.1:18:58194882:58209666:1 gene:ENSBTAG00000037906 transcript:ENSBTAT00000025840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIQAQETLTFDDVAVGFTWEEWQLLAPAQKALYRDVMLENYSNLVSAGFQASTPEVVSKL
DQGEPWMMDDETHCQTRSALLSQNLSYEIKSSNELIGDEKSCRHADSEQFHPEIKFPQSQ
KLISSKSPLNEHQKTKKTEKPHVCGECGKAFIKKSWLTDHQIIHTGEKPHRCNLCDKAFS
RKFMLTEHQRTHTGEKPYQCTDCGKAFLKKSRLNIHQKTHTREKRYICSDCGKGFIQKGN
LIVHQRIHTGEKPYTCNECGKGFIQKTCLIAHQRFHTGKTPFVCSECGKSCSQKSGLIKH
QRIHTGEKPFECSDCGKAFTTKQKLIVHQRTHTGERPYTCNECGKAFAYMSCLGKHKKIH
TREKPGDAIKGENPASQTSDAMREKSLVNLVAVQVPSMALQPSVNISGLLANRNVLITGP
PVGRCAPAGDDRGSAEDRTLKNAVSMVVPSVVNYVLFCVTE
Download sequence
Identical sequences E1B9A9
ENSBTAP00000025840 ENSBTAP00000025840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]