SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025854 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025854
Domain Number 1 Region: 2-155
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.36e-22
Family Canonical RBD 0.0002
Further Details:      
 
Domain Number 2 Region: 276-354
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.4e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 3 Region: 396-481
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.74e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 4 Region: 490-562
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 5 Region: 193-270
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000599
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025854   Gene: ENSBTAG00000019406   Transcript: ENSBTAT00000025854
Sequence length 580
Comment pep:known chromosome:UMD3.1:4:32077891:32222388:-1 gene:ENSBTAG00000019406 transcript:ENSBTAT00000025854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLYIGNLSENAVPSDLESVFKDAKIPVSGPFLVKTGYAFVDCPDDSWALKAIEALSGK
VELHGKLIEVEHSVPKRQRIRKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQVNTDSETA
VVNVTYSNKEQARQALDKLNGFQLENFTLRVAYIPDEMAAQQSPSQQPRGRRGFGQRGSS
RQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAA
EKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLK
KIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNL
QAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAITPPYPQFEQQSETETVHLFIPALSVGA
IIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENF
VSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKI
TGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPSQSRRK
Download sequence
Identical sequences F1MPB2
NP_001179217.1.59421 NP_001179217.1.76553 XP_005901319.1.15283 XP_019814103.1.53367 ENSBTAP00000025854 ENSBTAP00000025854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]