SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025999 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025999
Domain Number 1 Region: 401-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.15e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 191-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000066
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 358-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000113
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 4 Region: 443-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000069
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 151-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000605
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025999   Gene: ENSBTAG00000019518   Transcript: ENSBTAT00000025999
Sequence length 542
Comment pep:known chromosome:UMD3.1:11:72273637:72277103:1 gene:ENSBTAG00000019518 transcript:ENSBTAT00000025999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRKQSHPQPVKCEGVKVDTEDSLDEGPGALVLESDLLLGQDLEFEEEEEEEEEEGDRN
SDQLMGFERDSEGDSLGARPGLPYGLSDDESGGGRALSAESEVEEPTRGPGEARGERPGP
ACQLCGGPTGEGPCCGAGPGGGPPLPPRLLYSCRLCAFVSHYSSHLKRHMQTHSGEKPFR
CGRCPYASAQLVNLTRHTRTHTGEKPYRCPHCPFACSSLGNLRRHQRTHAGPPTPPCPTC
GFRCCAPRPARPPSPTEQEGAVPRRPEDALLLPDLSLHVSPGGASFLPDCGQLRGEGEGL
CGTGSEPLPELLFPWTCRNCGQELEEGEGSRLGAATCGRCMRGETGGSASGGPQGPSDKG
FACSLCPFATHYPNHLARHMKTHSGEKPFRCARCPYASAHLDNLKRHQRVHTGEKPYKCP
LCPYACGNLANLKRHGRIHSGDKPFRCSLCNYSCNQSMNLKRHMLRHTGEKPFRCATCAY
TTGHWDNYKRHQKVHGHGGAGGPGLSASEGWAPPHSPPPVLSSRGPTALGATSSRALHTD
SP
Download sequence
Identical sequences E1B7S0 L8IJX8
ENSBTAP00000025999 ENSBTAP00000025999 NP_001178224.1.59421 NP_001178224.1.76553 XP_005895799.1.15283 XP_019826085.1.53367 9913.ENSBTAP00000025999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]