SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026052 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026052
Domain Number 1 Region: 612-774
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.71e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0016
Further Details:      
 
Domain Number 2 Region: 754-869
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-23
Family Ypt/Rab-GAP domain of gyp1p 0.0089
Further Details:      
 
Domain Number 3 Region: 45-148
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-20
Family Pleckstrin-homology domain (PH domain) 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026052   Gene: ENSBTAG00000019550   Transcript: ENSBTAT00000026052
Sequence length 925
Comment pep:known chromosome:UMD3.1:8:63772483:63814993:-1 gene:ENSBTAG00000019550 transcript:ENSBTAT00000026052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAQESPAESGSSVPWSEEPAGSAKVPEVSLSEESEGCTRPLEATPPKLCGYLSKFGGK
GPIRGWKSRWFFFDERKCHLYYSRTAQDANPLDSIDLSSAVFDCKADAEEGTFEIKTPNR
IITLKAATKQAMLYWLQQLQMKRWEFHNSLPALPAAHDAALAGNGPALRLELEQEEEEEE
AFLCPVKTPTDLVGVAAAWQPVHARPLALQNISLKHLGTEIQNTMCNIRGNKQTQGANHR
PPGEDSPLIEETQREEQPSPPGPGAPGKDPANSLKSSLTTSLIRKAKSQSNTFPLFSEGL
MRNRTAQEKVLALEQQVLMLTKELKAQKELVKILHKALEAAQQEKRVSSAYLAAAQDKDR
LELVRHKVRQIAELGRRVEALERERESLAQTASLQEQEIRELQQHVQLLLDKNQAKQQVI
CKLSEKVTQDFMKAPEEADRDFLSQQEKMEHLKDDMEAYRTQNRFLNSEIHQVTKIWRKV
AEKEKALLMKCAYLQAQNCQVESKYLAGLRRLQEALGVEAGECSELLRQLIQEALQWEAS
EASADSVVLSPSTISEYDEYGFLTVPNYEVEDLRLLAKIQALEVHSHHLLAHEAVERPLR
ERWATLGELAPSAELKQLLRAGVPHEHRPRVWRWLIRLRVQHLQAPGCYQALLSRGQACK
HSAARQIELDLNRTFPNNKHFTCPTSSFPDKLRRVLLAFSWQNPTIGYCQGLNRLAAIAL
LVLDEEESAFWCLVAIVETIMPADYYSKTLLASQVDQRVLQDLLLEKLPRLMAHLGQRHV
DLSFITFNWFLVVFADSLISNILLQVWDAFLYEGIKVVFRYALAIFKYNEEALLRLQDSL
EIYQYLHFFTKTICDSRKLMHIAFNDMNPFPMKQLRQLRAAHRERLEAELNELEQLKAEY
LETRAAQGPAVPEGSPSEDEGEAEP
Download sequence
Identical sequences A6QP29
ENSBTAP00000026052 ENSBTAP00000026052 NP_001095451.1.59421 NP_001095451.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]