SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026227 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026227
Domain Number 1 Region: 118-200
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000734
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026227   Gene: ENSBTAG00000019679   Transcript: ENSBTAT00000026227
Sequence length 395
Comment pep:known chromosome:UMD3.1:18:46864524:46869490:-1 gene:ENSBTAG00000019679 transcript:ENSBTAT00000026227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPPPLGPRFPSELFSPPGAPRELDATGDTICIASGEESIRSEQAQKLGQDSLDPPEHF
RGGPRGLEPVAGLPRLPAPFSLEESAGSKNLEHPISGREVLEAEQDSLHLCLLGLGLWLQ
DLERGLGPCMSAQSRMVQLQALQADLRGAAERLDALLAFGEGLAQRSEPQAQAALEQVLS
TFRAHQDSIFQQLWRLQAQLVSTSLVLEEASTLEQDLEFEGDLDGPGPGGVWGPWAPSSL
PTPAELEWDPAGDIGDLEPLGRRTARTPGAPCELCGHRGPQSRGQSLEDMLMSGLSHRQH
VASHRRQPLLWKSRDRMRQASPSLQDVMLEADPGVPTPASRRPLTFFHLLLLLLFLFLVG
ITLFLPTSGGSCCSPAQLIGIPYLELSYVNGTPPM
Download sequence
Identical sequences E1BAH1
9913.ENSBTAP00000026230 ENSBTAP00000026227 ENSBTAP00000026230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]