SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026252 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026252
Domain Number 1 Region: 723-778
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000439
Family Classic zinc finger, C2H2 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026252   Gene: ENSBTAG00000019695   Transcript: ENSBTAT00000026252
Sequence length 1912
Comment pep:known chromosome:UMD3.1:3:106496805:106576048:-1 gene:ENSBTAG00000019695 transcript:ENSBTAT00000026252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGKGDAAATAGAGAEAPVGAGAGDGTETESMARGHSPASPAPVASGLRPCLWQLETEL
REQEVSEVSSLNYCRSFCQTLLQYASNKNASEHIVYLLEVYRLAIRSFASARPYLTTECE
DVLLVLGRLVLSCFELLLSVSESELPCEAWVLFLQSLQESHDALLEFGNNNLQILVHVTK
EGVWKNPVLLKILSQQPVETEEVNKLIAQEGPFFLQMRIKHLLKSNCIPQATALSKLCAE
SKEISNVSSFQQAYITCLCSILPNEDAIKEIAKVDCKEILDIICNLESEGQDNTAFVLCT
TYLTQQLQTASVYCSWELTLFWSKLQRRIDPSVDTFLERCRQFGVIAKTQQHLFCLIRVI
QTEAQDAGLGVSILLCVRALQLRTSEDEEMKASVCKTIACLLPEDLEVRRACQLTEFLIE
PSLDGFNMLEELYSQPDQKFDEENAPVPNSLRCELLLALKAHWPFDPEFWDWKTLKRHCH
QLLGQEASDSDDDLSGYEMSINDTDVLESFLSDYEEGKEDKQYRRRDVTDQHKEKRDKKP
IGSSERYQRWLQYKFFCLLCKRECIEARILHHSKMHMEDGIYTCPVCIKKFKRKEIFVPH
VMEHVKMPPSRRDRSRKKLLLKGSQKGICPKSPSAALEQGQSLNEQAKGESHEYVTFSKL
EDCHLQDRDLYPCPGTDCSRVFKQFKYLSVHLKAEHQNNDENAKHYLDMKNRREKCTYCR
RHFMSAFHLREHEQVHCGPQPYMCVSIDCYARFGSVNELLNHKQKHDDLRYKCELNGCNI
VFSDLGQLYHHEAQHFRDASYTCNFVGCKKFYYSKIEYQNHLSMHNVESSNGDVKKTVKL
EPAAGEKQDCIDQPHLLDQTDKSRLPEDLLFCAGSASSQIETTENLKENSDSNSSDQLSH
SSSASMNEELIDTLDHSETMQDILLSHEKVFVPSSLKEKCSNVAVCFDGTKFTCGFDGCG
STYKNARGMQKHLRKVHPYHFKPKKVKTKDLFPCLGNEHNPTTEKFDAEPKPSSDTNSDS
PDEGLDHNIHTKCKREHQGYSSEASICASKRPCTEDTMLELLLRLKHLSLKNSITHGSFS
GSLQGYPSSGAKSLQAVSATISDLNFQNQDENMPSQYLAQLAAKPFFCELQGCKYEFVTR
EALLMHYLKKHNYSKEKVLQLTMFQHRYSPFQCHICQRSFTRKTHLRIHYKNKHQIGSDR
VTQKLLDNEKCDHEGPCSVDRLKVDCPSELGGDPSGNSEKPHCHSKKDECSSETDLESSC
EETESKISDLSSPIGSHREEGEGREGRGSRRTVAKGNLCYILNKYHKPFHCIHKTCNSSF
TNLKGLIRHYRTVHQYNKEQLCLEKDKARTKRELVKCKKIFACKYKECNKRFLCSKALAK
HCSDSHNLDHIEEPKVLSEAESVARFSCNQPQCPAVFYTFSKLKHHLMEQHNIEGEIHSD
YEIHCDLNGCGQIFTHRSNYSQHVYYRHKDYYDDLFRSQKVANERLLRSEKVCQTAHPQG
HEHQTTRKSFNAKAKKCGLIKDKKAPISFKTRAEALHMCVEHSEHTQYPCMVQGCLSVVK
LESSIVRHYKRTHQMSSAYLEQQMENLVMCVKYGTKIKEEPISEAEPYIKKEEDGNCESE
LIQHSHPPADTSMPVQTADPLHPGERDGGQKGCTESNPVFDADSLLYRGTLKCNHSSETT
SLEQCNIVQPPPCKIENSIPNPDGTESGTYFTSFQLPLPRIKDSETGQQSSGQENTVKNS
THVPKENFRKHPQPRSFDLKTYKPMGFESSFLKFIQESEEKEDDFDDWEPSEHLTLSNSS
QPCNDLTGSVMANNMVNDNDPEVDIPHSSSDSAIHENLTAIPPLIVAETTTVPSLENLRV
VLDKALTDCGELALKQLHYLRPVVVLERSKFSTPILDLFPTKKTDELCVGSS
Download sequence
Identical sequences E1BAS5
ENSBTAP00000026252 ENSBTAP00000026252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]