SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026272 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026272
Domain Number 1 Region: 589-851
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.91e-90
Family Eukaryotic proteases 0.0000000458
Further Details:      
 
Domain Number 2 Region: 338-444
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 3 Region: 521-556
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 449-485
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 5 Region: 488-522
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000107
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 87-151
Classification Level Classification E-value
Superfamily SEA domain 0.000000209
Family SEA domain 0.01
Further Details:      
 
Domain Number 7 Region: 562-601
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000028
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026272   Gene: ENSBTAG00000019712   Transcript: ENSBTAT00000026272
Sequence length 852
Comment pep:known chromosome:UMD3.1:29:36933306:36971367:1 gene:ENSBTAG00000019712 transcript:ENSBTAT00000026272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSERARRGAGGSGDLGAGFKYTSRPENMNGCEEGVEFLPANNSSKVEKGGPRRWVVLMA
VLAAFLALSLLAGLLAWHFQDRNVRVQKIFNGYLSVRNENFLDAYENSNSTEFANLAKKV
KEALKFLYSGIPVLGPYHKTSTVTAFRQGVFIGHTDDQLQKEKETQHESVQGFSSQRLLC
GRARALGRMGFCSCSVWAHTGSIVVVHRFSCSAARGIFPDQGSSPNLGSIPGLGRSLFLP
GESHGQRSLVGYMMCILCLFTSYNSDVLTPGGLLTLERLRSPLEPLCLLNNPGASLCGPV
WLLLSATNCQLVSNKLFFQQQSSPIFVTCVSLPFFPGCGGYRAAQGTFNSPYYPGHYPPN
INCTWHIEVPDNKNVKVRFKAFFLQEPNVPVGSCTKDYVEINGEKYCGERPQFVASSRNN
KITVHFHSDQSYTDTGFLAEFLSFDARDPCPGSFMCNTGRCIRKELRCDGWADCTDYSDE
LDCKCNATYQFTCRDKFCKPLFWVCDSVKDCEDGSDEEGCSCPPNTFKCGNGKCLPQSQQ
CDRKDDCGDGSDEAKCQDGKAVPCTEHTHRCLNGLCVDKSNPQCDGNEDCTDGSDEKDCD
CGRRSFTRQSRVVGGENSDQGEWPWQVSLHAQGHGHLCGASLISPSWMISAAHCFVDDRG
FRYSEHSVWTAFLGLHDQSKRNAPGVQERGLQRIIKHPFFNDFTFDYDIALLQLDRPVEY
SATIRPICLPAADYTFPTGKAIWVTGWGHTQEAGQGAMILQKGEIRVINQTTCEHLLPQQ
ITPRMICVGYLSGGVDACQGDSGGPLSSPEEDGRMFQAGVVSWGEGCAQRNKPGVYTRLP
VFRDWIKAQIGV
Download sequence
Identical sequences F1N4X7
ENSBTAP00000026272 ENSBTAP00000026272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]