SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026393 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026393
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.49e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000418
Further Details:      
 
Domain Number 2 Region: 259-458
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 8.24e-63
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000161
Further Details:      
 
Domain Number 3 Region: 597-760
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.14e-40
Family AlaX-like 0.042
Further Details:      
 
Domain Number 4 Region: 521-593
Classification Level Classification E-value
Superfamily Translation proteins 4.16e-16
Family AlaX-M N-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026393   Gene: ENSBTAG00000019810   Transcript: ENSBTAT00000026393
Sequence length 968
Comment pep:known chromosome:UMD3.1:18:1829597:1850873:1 gene:ENSBTAG00000019810 transcript:ENSBTAT00000026393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTLTAGEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPVERLYVTYFGGDEAAGLEPDLECKQIWQNLGLDDSRILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNRETDGILKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGRVGAEDADGIDMAYRVLAD
HARTITVALADGGRPDNTGRGYVLRRILRRAVRYSHEKLNASRGFFATLVDVVVQSLGDA
FPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDSKTIPGDTAWLLYDTYGF
PVDLTALIAEEKGLVVDMDGFDEERKLAQLKSQGKGAGGEDLIMLDIYAIEELREKGLEA
TDDSPKYSYHSDSSGTYVFESAVATVMALRRDRMFVEEASTGQECGVVLDKTCFYAEQGG
QTYDEGYLVKVDDSSEDKTEFTVKNTQVRGGYVLHIGTLYGSLKVGDQVRLFIDEPRRRP
VMSNHTATHILNFALRSVLGEADQRGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMI
EAAKPVYTEDCSLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLTSV
EFCGGTHLQNSSHAGAFVIVSEEAIAKGIRRIVAVTGAEAQKALRKAESLKKSLCVVEAK
VKAQAAPNKDVQREIADLGEALATAIIPQWQKDEFRENLKSLKKVMDDLDRASKADVQKR
VLEKTKQLIDSSPNQPLVILEVESGASAKALNEALKLFKMHSPQTSAMLFTVDNEAGRIT
CLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQEALQLATSFAQ
LRLGDVKN
Download sequence
Identical sequences A6QLT9
ENSBTAP00000026393 ENSBTAP00000026393 NP_001094545.1.59421 NP_001094545.1.76553 XP_005218398.1.76553 XP_005218399.1.76553 XP_005218400.1.76553 XP_010812606.1.76553 XP_010849027.1.44457 XP_010849028.1.44457 XP_010849029.1.44457 XP_015331153.1.76553 XP_019834386.1.53367 XP_019834387.1.53367 XP_019834388.1.53367 XP_019834389.1.53367 9913.ENSBTAP00000026393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]