SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026492 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026492
Domain Number 1 Region: 377-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000115
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026492   Gene: ENSBTAG00000019885   Transcript: ENSBTAT00000026492
Sequence length 731
Comment pep:known chromosome:UMD3.1:X:14035125:14080978:-1 gene:ENSBTAG00000019885 transcript:ENSBTAT00000026492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYKKIFRKLDSSKMAELFMECEEEELEPWQKKVETPQEEDDELIFVGAVPGSKSPTSNI
VNRGNPSSSAKEIKNETESRKIVFVFHPESQSSSPEAAFPRFHPESRSSYNSDMAQNVSK
PDFAKNSSQVGLDESSDLPFSWSQNTVPLSQDGSTIYIEGLDETLPKIKHSDIIKIITVN
PKTSESVSEINPCASLSLTNCSSATSSYLMWSKGTHTLSTATRTGTFFVRACPKCNVQFN
LLDPLKYHMKVCCPDMVDVFMEMIKVELSNIEQNTTGAETGKLIMLVSDFYYGRHEGNFD
DDEKTYTTFKCFSCLKVLKNNIRFMNHMKHHLELEKQNTESWENHTTCQHCYRQYPTPFQ
LQCHIESTHTPLEFSTICKICELSFDTEHILLQHMKDTHKPGEMPYICQVCQFRSSSFTD
VETHFRVSHENTKNLLCPFCLKVSRMATPYMNHYMKHQKKGIHRCSQCRLQFLTYKEKLV
HKLEHRTFIKPKELEGLPPGTKVTIRASIESLHSGPSTSKSILSSSTSSSTCLQVSPSTS
KTTTTGSSPRSNANEYKTREFSATTSTESKPSTSKERAAKCRAKTSYKPKKKRNRRNKIS
VALKNLRCRGVYTCIECHTKIKDFASHFSLFTRCNFCKYSTNCNKAFVNHMLSSHTSQPA
KRVSIFKKRCRTLSRGITLVCLKCDFLADSSTLDRMAKHLSQRKTHTCQVIIETLPEGTS
AVNPFLLGSLQ
Download sequence
Identical sequences F1N3D2
ENSBTAP00000026492 ENSBTAP00000026492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]