SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026711 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000026711
Domain Number - Region: 157-248
Classification Level Classification E-value
Superfamily SNARE-like 0.00119
Family Clathrin coat assembly domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026711   Gene: ENSBTAG00000020047   Transcript: ENSBTAT00000026711
Sequence length 555
Comment pep:known chromosome:UMD3.1:22:50912976:50924039:1 gene:ENSBTAG00000020047 transcript:ENSBTAT00000026711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADMQRKRSSEGPDGTLAPSDGQSVERAESPTPGLAQGMEPGAGQEGAMFVHARSYEDL
TESEDGAASGESPKEGAGGPPPLATDMRQISQDFSELSTQLTGVARDLQEEMLPGSSEDW
PESPGAARRPATEPPRDGAGEGDEEEAAEAWRRHQKHVFVLSEAGKPVYSRYGSEEALSS
TMGVMVALVSFLEADKNAIRSIHADGYKVVFVRRSPLVLVAVARTRQSAQELAQELLYIY
YQILSLLTGAQLSHIFQQKQNYDLRRLLSGSERITDNLLQLMARDPSFLMGAARCLPLAA
AVRDVVSASLQQARARSLVFSILLARNQLVALVRRKDQFLHPIDLHLLFNLISSSSSFRE
GEAWTPVCLPKFNAAGFFHAHISYLEPDTDLCLLLVSTDREDFFAVSDCRRRFQERLRKR
GAHLALREALRTPYYSVAQVGVPDLRHFLYKSKSSGLFTSPEIEAPYDSEEEQERLLGLY
QYLHSRAHNASRPLKTIYYTGPNENLLAWVTGAFELYMCYSPLGTKASAVSAIHKLMRWI
RKEEDRLFILTPLTY
Download sequence
Identical sequences Q17QV2
ENSBTAP00000026711 ENSBTAP00000026711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]