SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026766 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026766
Domain Number 1 Region: 670-857,1170-1253,1443-1504
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.75e-103
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000096
Further Details:      
 
Domain Number 2 Region: 307-361,456-523
Classification Level Classification E-value
Superfamily DUSP-like 1.31e-23
Family DUSP, domain in ubiquitin-specific proteases 0.0038
Further Details:      
 
Domain Number 3 Region: 116-218
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000296
Family Calmodulin-like 0.015
Further Details:      
 
Domain Number 4 Region: 11-103
Classification Level Classification E-value
Superfamily EF-hand 0.0000000806
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026766   Gene: ENSBTAG00000020089   Transcript: ENSBTAT00000026766
Sequence length 1542
Comment pep:known chromosome:UMD3.1:19:12986898:13084710:1 gene:ENSBTAG00000020089 transcript:ENSBTAT00000026766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIYCSFGGTSKGLHFNNLIVGLVLLTRGRDEEKAKYIFSLFASESGSYVIREEMERMLHV
VDGKVPDTLRKCFSEGEKVNYEKFRNWLLLNKDAFTFSRWLLSGGVYVTLTDDSDTPTFY
QTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFGPLVSPPIRPSLSEGLFNAFDE
NRDNHIDFKEISCGLSACCRGPLAERQKYCFLLVQVNKLELFYKISKVILVKVSSEFFNS
IQNNHVIEIISKNSDEVANHLNHSATPLSVFNRNAYQGLAVKGVGNNFFYNDLEKVCHIV
LGLRPATPEEEGQIIRGWLERESRYGLQPGHNWFIISMQWWQQWKEYVKYDASPVVIEPS
SVLNGGKYSFGTTVHPIEQSEDRIGGGSPSYVNTTEEKFSDNVSSASEASETAGSGFLYS
ATPGTDMCFARQHNTSDNNNQCLLGANGNILLHLNPQKPGAIDNQPLVTQEPVKATSLTL
EGGRLKRTPQLIHGRDYEMVPEPVWRALYHWYGANLALPRPVIKNSKTEIPELELFPRYL
LFLRQQPATRTQQSNIWVNMGNVPSPNAPLKRVLAYTGCFSRMQTIKEIHEYLSQRLRIK
EEDMRLWLYNSENYLTLLDDEDHRLEYLKIQDEQHLVIEVRNKDMSWPEEMSFIANSSKI
DRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGH
MAKCYGDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHEDLN
RVHEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIVVDLFHGQLRSQVKCKTCGHISVR
FDPFNFLSLPLPMDSYMHLEITVIKLDGTTPVRYGLRLNMDEKYTGLKKQLSDLCGLKSE
QILLAEVHGSNIKNFPQDNQKVRLSVSGFLCAFEIPIPGSPISASSPIQTDFSSSPSTNG
MFTLTANGDLPRPIFIPNGMPNTVVPCGTEKNFTNGMVNGHMPSLPDSSFTGYIIAVHRK
MMRTELYFLSSQKNRPSLFGMPLIVPCTVHTRKKDLYDAVWIQVSRLASPLPPQEASNHA
QDCDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCKIDCGEDRAFIGNAYIAVDWDPT
ALHLRYQTSQERVVDEHESVEQSRRAQAEPINLDSCLRAFTSEEELGENEMYYCSKCKTH
CLATKKLDLWRLPPILIIHLKRFQFVNGRWIKSQKIVKFPRESFDPSAFLVPRAPALCQR
RPLTPQGDDLSEPRIPTGEVKKADAQNSAGEDVVLLSKSPSSLSANIVSSPKGSPSTSRK
SGTSCPSSKNSSPNSSPRTLGRSKGRLRLPQIGSKNKLSSSKENLDASKENGAGHVCELS
DALSRGHVLGGSQPELVTPQDHEVALANGFLYEHEACGNGYSNGQLENHSEEDSTDDQRE
DIHVKPIYNLYAISCHSGILGGGHYVTYAKNPNSKWYCYNDSSCKELHPDEIDTDSAYIL
FYEQQGIDYAQFLPKIDGKKMADTSSMDEDFESDYKKYCVLQ
Download sequence
Identical sequences F1N3S5
ENSBTAP00000026766 ENSBTAP00000026766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]