SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027030 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027030
Domain Number 1 Region: 37-123,150-207
Classification Level Classification E-value
Superfamily EF-hand 0.000000296
Family Calmodulin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027030   Gene: ENSBTAG00000020281   Transcript: ENSBTAT00000027030
Sequence length 1910
Comment pep:known chromosome:UMD3.1:10:43642813:43692975:-1 gene:ENSBTAG00000020281 transcript:ENSBTAT00000027030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HWKTQRSEEYEAEGQLRFWNPDDLKASQTGSLAPQDWIEEKLQEVCEDLGITRDGHLNRK
KLVSICEQYGLQNVDGEMLEEVFHNLDPDGMMSVEDFFYGLFKNGKPLTPSASTPYRQLK
RHISMQSFDESGRRTTAPSAMMSTIGFRVFSCLDDGMGYASVERILDTWQEEGIENSQEI
LKALDFSLDGNVNLTELTLALENELLVTKNSIHQAALASFKAEIRHLLERVDQMLREKEK
LRSDLDKAEKLKSLMASEVDDHHAAIERRNEYNLRKLDEEYKERIAALKNEFRKEREQIL
QQVGKQRLELEQEIEKAKTEENYVRDRLALSLKENSRLENELLENAEKLAEYESLTNKLQ
RNLENVLAEKFGDLDPSSAEFFLQEERLTQMRNEYELVFKFQLLQDQVDELQSELQEYRT
QGKVSRLPLQNSLSEELDINSGCIEPDQGLGSEECNPLNMSIEAELVIEQMKEQHHRELC
HLRLELEDKVNYYEKQLDETKVAFEKEQENMKLKCENEVHILEEQISDLKNKIAELQGQT
EVLKEAQHVAICRHEEEKKQLQMKWDEEKAHVQEELRLEHEMALRARLEQVEESFNRERE
RLVQNGAWTEEKVRGLTQKLEQVHQEQLKSLVEKHILEKEELQKELLEKHQRELHEGREK
METECNRRTSQIEAQFQADCQKVTERYEHALRSLEVHYRHQLKELLDQQCEERSQWEFEK
DELTQECAEAQEQLKETLQREKATSLVLTQEREMLEKTYKEHLNSMVVEREQLLQDLEDL
RKVSESQQSLLSNQILELKSSHERELKDREQILCQAGTSEQLVSQRLEQLQREHDQERQE
MMSKLLVMESVHRATCEKADRERAEMSTEISRLQNKIKEMEQVVSPPSRLQNSCQVIGGE
EAEENGAMSLLQQGEQLLEENGDVLLSLQRAHERAVKENVKMATEISRLQQRLQKLEPES
VMSSCLDEPATGLFGNSVEQTEPFLQPNRIKQAEGGTTQRILSDLQGDEVRDLESTGTSS
GQRQVRVEESEASIESFSELENSEETRTETWDLKNQVGQLREQLMILRADCDRASEKKQD
LLFDVSVLKKKLKMLERIPEASPKYKVLYEDASRENECLQEELRMMETRYDEALESNKEL
TSEMFRLQDELKKVEEMTDTFLSLEKSYKEIKRENEELHVLVLRLQGKIEKLRERAVDER
VPNVMSVHHIIEEHLYQENQYLEQENTQLLEKVKAHEIAWLHGTLQTHRDKLGAQNALVK
QKDVPSQGEKEEELKAMMHDLQITCSEMQQKVELLRYESEKLQEENSILRNEITTLNEED
SISNLKLGKLSGSQEEMWQKIETVKQEKAAVQKMVENLKKQISELKTKNQQLDLENMKLS
QKNSQNQKELQELNQRLAEMLSQKDKEPGHSACEEWEQEKSNLKEELEHCKLQSSTLVSS
LEAELSEVKIQTHIVEQENLLLKDELEKVKQLCRCPDLSDFQQKISSILSHNEKLLKEKE
ALSEELNICVDKKQLAKSSLLEHRIATMKQEQKSWEHQSESLKSQLVASQEKVQNLEDTL
QNVNLQMSRIKSDLRVTQQEKEALKQEVMSLHKQLQNASDKNWAPEIGIHPSGFHNQQQR
LSWDKLDHLINEEQQLLWQENERVQTMVQNTKPELIHSREKVRQLESNLPSPKHQKHLNS
SGTVKPTEQEKLSLKRECEQFQKERSPTNRKVSQMKSLERELETIHLENEGLKKKQMQHL
RSTVMLSPSPHAWELQLLQQQTCPVVPREQFLQLQRQLLQAERINQCLQEELENRTSETN
TPQGNQEYLVTVMEERMLEVEQKLKLVKRLLQEKVNQLKEQLCKNTKADAIVKDLYVENA
QLLKALEMTEQRQKTAEKKNYLLEEKIASLSNIVRNLTPAPLTSTPPLRS
Download sequence
Identical sequences E1BMB1
ENSBTAP00000027030 ENSBTAP00000053270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]