SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027039 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027039
Domain Number 1 Region: 433-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.53e-26
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 517-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 376-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.73e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 10-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-19
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 5 Region: 558-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-16
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 344-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000285
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 266-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000146
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 8 Region: 479-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000565
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 9 Region: 227-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000183
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027039   Gene: ENSBTAG00000020289   Transcript: ENSBTAT00000027039
Sequence length 616
Comment pep:known chromosome:UMD3.1:15:46368597:46371546:1 gene:ENSBTAG00000020289 transcript:ENSBTAT00000027039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLPGKLIFDQMAVTFEDVTVIFTWEEWKFLDSSQKKLYREVMWENYTNVMLVGNWKESC
KPQEERFRYLDHENLSCWQGWKTARTPIYENKNYVEMVQGIDSKALKQQHLSHYQEWSTL
PTQVAGYGNYELTFESKSPRNLKYTKCIPCQSLERKHSEDDGRKIYVSDSCGFQGLRYPV
GISRKNLSLEKEQKLIRQHSIPGQEAFPEYIGEICQNDLLKGSMEEKYCGCKKCKEIYYW
NSQCVLHKRNQLGEKFYPCSISPTWFPQRSDLYRHPRIHTGKQLYRCDEVASNLSQSFGV
HFHQRAHPGEAPYVCNLCSNSFSQIPRLHHDQRIHLEEKLYKLQCDKDLGRNSLLHIHQR
LHIGEKPFKCDQCGKSFSRSSVLHVHQRVHTGEKPYKRDECGKGFSQSSNLRIHQLVHTG
EKSYKCGDCGKGFTQRSNLQIHQRVHTGEKPYKCDNCGKDFSHSSDLRIHQRVHTGEKPY
ICHECGKGFSKSSKLHTHQRVHTGEKPYKCEQCGKGFSQRSHLLIHQRVHTGEKPYRCDD
CGKGFSHSSNLHIHQRIHTGEKPYQCAKCGKGFSHSSALRIHQRVHTGEKTYKCHEYYKG
FNQNSHLYNNCRRETL
Download sequence
Identical sequences G3X7G3
ENSBTAP00000027039 ENSBTAP00000027039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]