SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027056 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027056
Domain Number 1 Region: 313-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.89e-21
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 369-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-17
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 3 Region: 274-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027056   Gene: ENSBTAG00000020302   Transcript: ENSBTAT00000027056
Sequence length 458
Comment pep:known chromosome:UMD3.1:22:39068359:39073040:1 gene:ENSBTAG00000020302 transcript:ENSBTAT00000027056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSASLETMVPPACPRAGASPATSKTLAFSIERIMAKTSEPRAPFEPRPGALEADSGQG
KKLLNLCSPLPCMIPLQPLGYEMPSKTLLSYSELWKSSLRAGGSGGGGGGGGGGGGAPVC
GASGLCKTNCGVCCKAELGLVPSALPAGRVIKPQVINQAVGLPASGSLYYFNYLDSATYP
SSELLGGHLFPSGLLNTQAPAALAAHPKLFLLENAKLAGLTADKFAHPAPYAHKERLPAP
LEQVLKENSALTAERGGVKGHSKLPGGSADGKPKNFTCEVCGKVFNAHYNLTRHMPVHTG
ARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPF
VCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCAT
CGKGFCRNFDLKKHVRKLHDSVGPAAPSTKDLTRTVQS
Download sequence
Identical sequences Q2VWH6
NP_001033287.1.59421 NP_001033287.1.76553 XP_010815953.1.76553 ENSBTAP00000027056 ENSBTAP00000027056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]