SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027088 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027088
Domain Number 1 Region: 259-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.91e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 307-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000165
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 220-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000141
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027088   Gene: ENSBTAG00000020327   Transcript: ENSBTAT00000027088
Sequence length 478
Comment pep:known chromosome:UMD3.1:10:85669290:85711371:1 gene:ENSBTAG00000020327 transcript:ENSBTAT00000027088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSDELESKPELLVQFVQNTSIPLGQGLVESEAKDITCLSLLPVTEASECSRLMLPDDTP
NHTNSSKEVPSSAVLRSLQVNVGPDGEETRAQTVQKSPEFLSTPESPSLLQDLQPSDSTS
FILLNLTRAGLGSSAEHLVFVQDEADDSGNDFLSSESTDSSIPWFLRVQELAHDSLIAAT
RAQLAKNAKTSSNGENVHLGSGDGQPKDSGPLPQMEKKLKCTVEGCDRTFVWPAHFKYHL
KTHRNDRSFICPAAGCGKSFYVLQRLKVHMRTHNGEKPFVCPESNCGKQFTTAGNLKNHL
RIHTGEKPFLCEAQGCGRSFAEYSSLRKHLVVHSGEKPHQCQVCGKTFSQSGSRNVHMRK
HHLQMGAAGSQEQEPAAEPLMGSSLLEEASVTSKNLVSMNSQPSLGGESLNLPNTNSILG
VDDEVLAEGSPRPLSSVPDVTHHLVTMQSGRQSYEVSVLTAVNPQELLNQGDLTERRT
Download sequence
Identical sequences Q3ZBC5
XP_005212056.1.76553 XP_015328713.1.76553 9913.ENSBTAP00000027088 ENSBTAP00000040756 ENSBTAP00000027088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]