SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027106 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027106
Domain Number 1 Region: 49-84
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000506
Family HkH motif-containing C2H2 finger 0.038
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000027106
Domain Number - Region: 268-334
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0327
Family Occludin/ELL domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027106   Gene: ENSBTAG00000020340   Transcript: ENSBTAT00000027106
Sequence length 373
Comment pep:known chromosome:UMD3.1:19:15446157:15447896:-1 gene:ENSBTAG00000020340 transcript:ENSBTAT00000027106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSASARPPAGKRVVNQDELRRLMKEKQRLSTNRKRIESPFAKYNRLGQLSCALCNTPV
KSELLWQTHVLGKQHREKVAELKGAKEAAQGPSASAVPQSTKRKAPDSESQDAKRAKASL
VPQVQPSTSALPTNFDKAGKESTRATVGKASGLGLLPDYDDEEDEEEEKGGGGGEGKKGD
ACKQPSTSQSKEHSLSSSREATGSRLPSNFSDTNPPKAPLIPHSGSIEKAEIHEKVVERR
ENTAEALPEGFFDDPEIDARVRKVDAPKDQMDKEWDEFQKAMRQVNTISEAIVAEEDEEG
RLDRQIGEIDEQIECYRRVEKLRNRQDEIKNKLKEVLTIKELQKKEEENVDSDDEGELQD
LLSQDWRVKGALL
Download sequence
Identical sequences A3KN01 L8IAN7
ENSBTAP00000027106 9913.ENSBTAP00000027106 ENSBTAP00000027106 NP_001076081.1.59421 NP_001076081.1.76553 XP_005899749.1.15283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]