SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027125 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027125
Domain Number 1 Region: 408-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000682
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 441-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000303
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027125   Gene: ENSBTAG00000020355   Transcript: ENSBTAT00000027125
Sequence length 477
Comment pep:known chromosome:UMD3.1:8:98843684:98847740:-1 gene:ENSBTAG00000020355 transcript:ENSBTAT00000027125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSDALLPSFSTFASGPAGREKTLRPAGAPNNRWREELSHMKRLPPVLPGRPYDLAAAT
VATDLESGGVGAACGSSNPALLPRRETEEFNDLLDLDFILSNSLSHQESVAATVSSSASA
SSSSSPSSSGPASAPSTCSFSYPIRAGGDPGVAAPGGAGGGLLYGRESAPPPTAPFNLAD
INDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVIS
VSKGSPDGSHPVVVAPYSGGPPRMCPKIKQEAVSSCTVGRPLEAHLGTGPPLSNGHRPPA
HDFPLGRQLPSRTTPTLGAEELLSSRDCHPALPLPPGFHPHPGPNYPPFLPDQMQPQVPP
LHYQELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTG
EKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
Download sequence
Identical sequences A0A0N9WV34 A7YWE2
ENSBTAP00000027125 NP_001098855.1.59421 NP_001098855.1.76553 ENSBTAP00000027125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]