SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027192 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000027192
Domain Number - Region: 258-299
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0314
Family Frizzled cysteine-rich domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027192   Gene: ENSBTAG00000020406   Transcript: ENSBTAT00000027192
Sequence length 580
Comment pep:known chromosome:UMD3.1:X:17305874:17770661:-1 gene:ENSBTAG00000020406 transcript:ENSBTAT00000027192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTVRTACLVVAMLLSLDCPGQAQPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGS
DLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVR
HAKNYTNAMFKNNYPSLTPQAFDFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYT
QLMNPGLPESTLDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVI
NTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYI
LSLEELVNGMYRVYDMENVLLGLFSTIHDSIQYVQKNGGKLTTTIGKLCAHSQQRQYRSA
YYPEDLFIDKKVLKVARVEREETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDT
LCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSVPK
GRVLDKNLDEEGLESGDCGDDEDECIGGSGDGMMKVKNQLRFLAELAYDLDVDDAPGSKQ
HVNQKDNEIVASHNLGNGHPPLKLLTSLAISVLCFFLLVH
Download sequence
Identical sequences Q3ZBZ6
NP_001030540.1.59421 NP_001030540.1.76553 ENSBTAP00000027192 ENSBTAP00000027192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]