SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027209 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027209
Domain Number 1 Region: 6-315
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-85
Family Protein kinases, catalytic subunit 0.00000000156
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000027209
Domain Number - Region: 349-429
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00384
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027209   Gene: ENSBTAG00000020417   Transcript: ENSBTAT00000027209
Sequence length 454
Comment pep:known chromosome:UMD3.1:7:21265025:21278270:1 gene:ENSBTAG00000020417 transcript:ENSBTAT00000027209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENRTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRREDSGRKPERRRLKTA
RLKEYTIKSHSSMPPNNTYINFERFSKVLEEVAAAEEGLRGLEHSRRLFHEDLEALTAIY
EEKEAWYREENESLGQDLRRLRQELHKTEALQRQAQEEAKGALLGASGLKRRFSRLENRY
EALAKQVASEMRFVQDLVRAMEQEKLQEGECSLR
Download sequence
Identical sequences A0A212D1L3 A7MB69
ENSBTAP00000027209 ENSBTAP00000027209 9913.ENSBTAP00000027209 NP_001094594.1.59421 NP_001094594.1.76553 XP_005209003.1.76553 XP_005682630.1.57651 XP_006042596.1.26621 XP_010826432.1.44457 XP_011994901.1.54773 XP_011994902.1.54773 XP_011994903.1.54773 XP_011994904.1.54773 XP_017906339.1.57651 XP_019820018.1.53367 XP_019820019.1.53367 XP_020750980.1.74333 XP_020750981.1.74333 XP_020750982.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]