SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027212 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027212
Domain Number 1 Region: 2-139
Classification Level Classification E-value
Superfamily SNARE-like 4.21e-46
Family Clathrin coat assembly domain 0.0000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027212   Gene: ENSBTAG00000020420   Transcript: ENSBTAT00000027212
Sequence length 160
Comment pep:known chromosome:UMD3.1:X:134965647:134991291:1 gene:ENSBTAG00000020420 transcript:ENSBTAT00000027212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKR
YASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGG
EVQETSKKNVLKAIEQADLLQEDAKEAETPRSVLEEIGLT
Download sequence
Identical sequences A0A1L8HD07 A0A1S3AQB9 A0A1U7Q9Z5 A0A1U7SS41 A0A2I3HZ89 A0A2I3LI26 A0A2I3SGT4 A0A2K5D5U4 A0A2K5HDE1 A0A2K5N4T7 A0A2K5PF55 A0A2K5TU05 A0A2K5XGK1 A0A2K6B8F7 A0A2K6G7J6 A0A2K6NFI9 A0A2K6T121 F6SFB5 G3RCW2 H0W6U9 H2PV00 H9G1E5 I3MBS1 M3XUG7 Q28C71 Q3ZBS3 Q9DB50 U3EKV2
ENSPPYP00000022541 ENSMPUP00000002717 ENSBTAP00000027212 ENSMUSP00000066185 ENSBTAP00000027212 10116.ENSRNOP00000059585 ENSP00000444957 ENSMUSP00000066185 gi|113931322|ref|NP_001039110| gi|89268919|gb|CAJ82923| ENSPPYP00000022541 ENSMUSP00000066185 NP_001035681.1.59421 NP_001035681.1.76553 NP_001039110.1.99540 NP_001259000.1.87134 NP_001259000.1.92137 NP_001277308.1.92730 XP_002929782.1.58354 XP_004269703.1.21590 XP_004476722.1.11602 XP_004667986.1.11716 XP_004758951.1.14098 XP_005000560.1.53824 XP_005037416.1.66865 XP_005074270.1.91757 XP_005287838.1.60341 XP_005358822.1.66349 XP_005593098.1.63531 XP_005614068.1.31192 XP_005641195.1.84170 XP_005673510.1.46622 XP_005876688.1.60319 XP_005903170.1.15283 XP_006088634.1.53796 XP_006158012.2.99106 XP_006256922.1.100692 XP_006775268.1.95426 XP_007183025.1.59432 XP_007431937.1.37977 XP_007466383.1.90284 XP_007500929.1.35504 XP_007538707.1.11023 XP_007668620.1.37387 XP_007989310.1.81039 XP_008048355.1.4292 XP_008105459.1.98722 XP_008153153.1.99482 XP_008270603.1.1745 XP_008581433.1.73410 XP_008694621.1.72690 XP_008827973.2.79516 XP_008968491.1.60992 XP_008987248.1.60252 XP_009275145.1.47732 XP_009667499.1.43253 XP_010212948.1.20684 XP_010334958.1.74449 XP_010641927.1.5607 XP_010966310.1.22495 XP_011246071.1.92730 XP_011361281.1.92234 XP_011587750.1.59079 XP_011587751.1.59079 XP_011733515.1.29376 XP_011795645.1.43180 XP_011850917.1.47321 XP_011891180.1.92194 XP_011891181.1.92194 XP_012026316.1.54773 XP_012289931.2.9421 XP_012289974.1.9421 XP_012289982.1.9421 XP_012356392.1.23891 XP_012424957.1.42559 XP_012494180.1.63892 XP_012585828.1.23501 XP_012640202.1.48125 XP_012921479.1.39548 XP_012949910.1.99704 XP_013039395.1.65836 XP_013807054.1.3284 XP_013926939.1.67126 XP_014125891.1.73095 XP_014646610.1.5094 XP_014713135.1.49734 XP_014731339.1.99236 XP_014815722.1.91963 XP_014937143.1.86478 XP_014960289.1.66739 XP_014982446.1.72884 XP_015107262.1.17985 XP_015128653.1.86415 XP_015273106.1.55130 XP_015273107.1.55130 XP_015273108.1.55130 XP_015444643.1.64745 XP_015479634.1.82291 XP_015741944.1.68032 XP_015741993.1.68032 XP_015742003.1.68032 XP_015742009.1.68032 XP_015742018.1.68032 XP_015847544.1.50099 XP_015974267.1.101085 XP_017374767.1.71028 XP_017374768.1.71028 XP_017457498.1.100692 XP_017457499.1.100692 XP_017512669.1.32401 XP_017583966.1.15636 XP_017667736.1.3805 XP_017899389.1.57651 XP_017939543.1.51550 XP_018101524.1.7800 XP_018418570.1.44173 XP_018418571.1.44173 XP_018769109.1.15306 XP_018874752.1.27298 XP_019138321.1.2935 XP_019273522.1.44245 XP_019350545.1.47583 XP_019379810.1.87953 XP_019384822.1.79039 XP_019521948.1.44202 XP_019679144.1.62641 XP_020369197.1.65276 XP_020735096.1.74333 XP_020863047.1.61212 XP_020863048.1.61212 XP_021043169.1.100879 XP_021388017.1.53032 XP_021578584.1.77405 ENSRNOP00000059585 ENSMPUP00000002717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]