SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027421 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027421
Domain Number 1 Region: 518-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000348
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 241-369
Classification Level Classification E-value
Superfamily SET domain 0.0000000000654
Family Histone lysine methyltransferases 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027421   Gene: ENSBTAG00000020578   Transcript: ENSBTAT00000027421
Sequence length 590
Comment pep:known chromosome:UMD3.1:7:31950213:32058001:-1 gene:ENSBTAG00000020578 transcript:ENSBTAT00000027421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKPGDPGGSAFLKVDPAYLQHWQQLFPHGGGGPLKGGGAAGPLGAPQPLQPPPPPERAE
PQPDSLRPRPASLSSASSTPASSSTSASSASSCAAAAAAAAAAALAGLSALPVAQLPVFA
PLATVAAEPLPPKDLCLGATSGPGPSKCGGSGGDGRGVPRFRCSAEELDYYLYGQQRMEI
IPLNQHTSDPNNRCDMCADNRNGECPMHGPLHSLRRLVGTSSAAAAAPPPELPEWLRDLP
REVCLCTSTVPGLAYGICAAQRIQQGTWIGPFQGVLLPPEKVQAGAVRNTQHLWEIYDQD
GTLQHFIDGGEPSKSSWMRYIRCARHCGEQNLTVVQYRSNIFYRACIDIPRGTELLVWYN
DSYTSFFGIPLQCIAQDENLNVPSTVMEAMCRQDALQPFNKSSKLSQAPQQRSVVFPQTP
CGRNFSLLDKSGPLESGFNQISVKNQRVLASPTSTSQLHSEFSDWHLWKCGQCFKTFTQR
ILLQMHVCTQNPDRPYQCGHCSQSFSQPSELRNHVVTHSSDRPFKCGYCGRAFAGATTLN
NHIRTHTGEKPFKCERCERSFTQATQLSRHQRMPNECKPITESPESIEVD
Download sequence
Identical sequences A6QPM3
ENSBTAP00000027421 9913.ENSBTAP00000027421 ENSBTAP00000027421 NP_001096725.1.59421 NP_001096725.1.76553 XP_010844596.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]