SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027448 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027448
Domain Number 1 Region: 460-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.48e-17
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 292-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-16
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 3 Region: 403-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000154
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 501-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000717
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 253-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000231
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 368-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000365
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027448   Gene: ENSBTAG00000020601   Transcript: ENSBTAT00000027448
Sequence length 742
Comment pep:known chromosome:UMD3.1:20:9075831:9094324:1 gene:ENSBTAG00000020601 transcript:ENSBTAT00000027448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKELKMVKDEDVHFSLGVKRAPSFPHGLQPVVSRGKAPPGHPFPEALRGPFSQFRYEPP
PGELDGYPGVFEGGGSRKRKSMPTKMPYNHPAEEGALGLHPEESKNPGVPDLPLLFPPPP
PPRPKYDSRMIDLCNVGFQFYRSLEHLGGKAVKQEPVKPSAVWPAPAAPPFLPAPYPYYP
KVAPGLVFPFFVPSASPFPFSRHTFLPKRPPEPPLPRKAEPPESEETKQKVERVDVNVQI
DDSYYVDVGGAQKRWQCPTCEKSYTSKYNLVTHILGHSGIKPHACSRCGKLFKQLSHLHT
HMLTHQGTRPHKCQVCHKAFTQTSHLKRHMMQHSEVKPHNCRVCGRGFAYPSELKAHEAK
HASGRENICVECGLDFPTLAQLKRHLTTHRGPIQYNCSECDKTFQYPSQLQNHMMKHKDI
RPYICSECGMEFVQPHHLKQHSLTHKGVKEHKCGICGREFTLLANMKRHVLIHTNIRAYQ
CHLCYKSFVQKQTLKAHMIVHSDVKPFKCKLCGKEFNRMHNLMGHMHLHSDSKPFKCLYC
PSKFTLKGNLTRHMKVKHGVMERGLHSQGFGRGRIALAPTAGALRSLEQEEPFDLSQKRR
AKGPAFQSDGESARGSSCHEEEDEDNCYEVEPDSPGLGPRGPPLCAPRDLSAKPEPGPGE
EAPAEEASPPGARPLKSRDSLGPEGGPEREFARRDERPGLRVLPSTRRGPAFSDYLYFKH
RDESLKELLERKMEKQAVLLGI
Download sequence
Identical sequences E1BCS0
9913.ENSBTAP00000027448 ENSBTAP00000027448 ENSBTAP00000027448 NP_001179214.1.59421 NP_001179214.1.76553 XP_005221472.1.76553 XP_005221473.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]