SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027510 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000027510
Domain Number - Region: 200-242
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0419
Family Frizzled cysteine-rich domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027510   Gene: ENSBTAG00000020644   Transcript: ENSBTAT00000027510
Sequence length 505
Comment pep:known chromosome:UMD3.1:X:17087447:17122426:-1 gene:ENSBTAG00000020644 transcript:ENSBTAT00000027510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGDHLKICLQGYTCCSQEMEEKYSLQSKEDFKSVVSEQCNHLQAVFASRYKKFDEFFKE
LLENAEKSLNDMFVKTYGHLYMQNSELFKDLFEELKRYYVAGNVNLEEMLNDFWARLLER
MFRLVNSQYHFTDEYLECVSKYTEQLKPFGDVPRKLKLQVTRAFVAARTFAQGLAVARDV
VSKVSVVNPTTQCTHALVKMMYCSHCQGLVTVKPCYNYCSNIMRGCLANQGDLDLEWNNF
IDAMLMVAERLEGPFNIESVMDPIDVKISDAIMNMQENSVQVSQKVFQGCGPPKPLPAGR
ISRSISEGTFSARFRPFHPEERPTTAAGTSLDRLVTDVKEKLKQAKKFWSSLPSSVCNDE
RMAAGSGNEDDCWNGKGQSRYLFAVTGNGLANQGNNPEVQVDTSKPDILILRQVMALRVM
TSKMKNAYNGNDVDFFDISDESSGEGSGSGCESQQCPSEFEYNATDHSGKSANDKASSAG
VPAAAWPYLLPVFCILSLVMQREWR
Download sequence
Identical sequences F1MCX1
ENSBTAP00000027510 ENSBTAP00000027510 9913.ENSBTAP00000027510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]