SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027639 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027639
Domain Number 1 Region: 38-156
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.02e-41
Family Frizzled cysteine-rich domain 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027639   Gene: ENSBTAG00000020742   Transcript: ENSBTAT00000027639
Sequence length 589
Comment pep:known chromosome:UMD3.1:25:34245429:34247198:-1 gene:ENSBTAG00000020742 transcript:ENSBTAT00000027639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVPPLRRALLLWQLLAAGGAALEIGRFDPERGRGPAPCQVVEIPMCRGIGYNLTRMPNL
LGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARL
RCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPTEPHKGLGMLPVAPRPA
RPAEDALQGAGGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALC
FFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGALY
VIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAA
WGLPALKTIVILTLRKVAGDELTGLCYVANMDAAALTGFVLVPLSCYLVLGTSFLLTGFV
ALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRATE
QACSAATTPGGRRDCSLQGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCH
RKMAAGRARAKACRAPGGYGRGTHGHYKAPTVVLHMTKTDPSLENPTHL
Download sequence
Identical sequences F1MBL4
XP_002698235.1.76553 XP_599625.4.59421 ENSBTAP00000027639 ENSBTAP00000027639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]