SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027644 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027644
Domain Number 1 Region: 152-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000409
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 2 Region: 1695-1743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000021
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 3 Region: 598-628
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000142
Family Classic zinc finger, C2H2 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027644   Gene: ENSBTAG00000020745   Transcript: ENSBTAT00000027644
Sequence length 2128
Comment pep:known chromosome:UMD3.1:3:105213590:105268006:1 gene:ENSBTAG00000020745 transcript:ENSBTAT00000027644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STAATQEGPLQELLAPQPFPGPSSVLREGSQEKTGQPQKPPKRSSIEASVHISQLPQHPL
TPAFMSPGKPEHLLEGSTWQLVDPMRPGPSGSFVTPGLHPQSQLLSSHASIIPPEDLPGI
PKVFVSRPSQVSLKPTEEAHKKERKPQKPGKYICQYCSRPCAKPSVLQKHIRSHTGERPY
PCGPCGFSFKTKSNLYKHRKSHAHRIKAGLASGMGGEMYPPGLEMERIPGEEFEEPTEGE
STDSEEETGTTSTHPTELSPRPKHPLLSSSLYSSGSQGSSHERCSLSQSSSAPSLEDPAP
FAEPSSEHPLSHKPEDTHTIKQKLALRLSERKKVIDEQAFLSPGSKGSTESGYFSRSESA
EQQVSPPNTNARSYAEIIFGKCGRIGQRTAMLTATSTQPLLPLSTEDKPSLVPLSVPRTQ
VIEHITKLITINEAVVDTSEIDSVKPRRSSLSRRSSMESPKSSLYREPLSSHSEKAKPEQ
SLLSLQRPPSTTPPVPLLRSHSMPSATCTLSTPHHTFRGSYSFDDHVADSEALSRSSQLF
TSHPRMLKRQPAIELPLGGEYSSEEAGPSSKDAASKPADEPEPRESDLTKKTKKGLKTKG
VIYECNICGARYKKRDNYEAHKKYYCSELQLAKPVTVGAHMMHYKLGTTLELTPLRKRRK
EKSLGDEEEPPSFESTKSQFGSPGPSEAARNLPLESSKSPAEPNKSVPSLEGSAGFQPRT
PKPGSSSESGKERRTTSKEISVIQHTSSFEKSDSLEQPGSLEGEDKSAAPFSSPPPAPHG
RSAHSLQPRLVRQPNIQVPEILVTEEPDRPDTEPEPPPKEPEKTEEFQWPQRSQTLAQLP
AEKLPPKKKRLRLAEMAQSSGESSFESSVPLSRSPSQESSVSLSGSSRSASFERDDHGKA
EAAGPSSDTRSKPLGTHMLTVPSHHPHAREMRRSASEQSPNISHSTHMTETRSKSFDYGS
LSLTGPSAPTPAAPVASAAPPERRKCFLVRQASLTRPPETEPEATPKGRQESEEPKPSSS
KSLAKGALLPVSSAATSHSGHPGGKSQVQDRPALGATPPYTEALQVFPHPIAQLPLQEKP
YLPPPVSLFSFQHLLQHEPEFFPTQAMSSLLSTPYSMPPLPPSLFQAPPLPLQPTVLHPG
QLHLPQLMPHPANIPFRQPPSFLPMPYPASSALSSGFFLPLQSQFTLQLPSEVESHVPQI
KTSLATLATGTPGLSPSTEYSSDIQLPTVAPPSSCSAPTSAPPLALPACPDTMVSLVVPV
RIQTNMPSYGSAMYTTLSQILVTQSQGSSATVALPKFEEPSCKGTSVCGTDAYEVGPRLA
GVSEEQSRGFPTPFLRVPVTLPERKGTSLASESVLSLEGSSSTVGGSKRVLSPAGSLELT
METQQQKRVKEEEASKVDEKFELVKPCSVVLSSTEDSKRSEKSYLGSQGQGRRELETLSS
LSSDPSDPKEIPPLPQPSLPHVTTSGSEALKEYAQPSGKPHRRGLLPSSVKKEDSKEQAD
LPPLAPPSSQSLSETSPRPAKLQEGTDSKKVLQFPSLHTTTNVSWCYLNYIKPNHIQHAD
RRSSVYAGWCISLYNPNLPGVSTKAALSLLRSKQKVSKETYTMATAPHPETGRLVPSSSR
KPRMTEYPSLPIIQGKKTVKKGLGRVLKEEEKRGKPEEDAPASKRGEPARIKIFEGGYKS
NEEYVYVRGRGRGKYVCEECGIRCKKPSMLKKHIRTHTDVRPYVCKHCHFAFKTKGNLTK
HMKSKAHSKKCQETGVLEELEAEEGLNTNQKEKDSEGREGAEAVAEHQFSDLDDSDSDSD
LDEDEDEDEEESQDEPSGPSSEAPPPGPPATLPADSSPVQGPQPTEATRGSSVSEAERSA
PSSCSTSSQSILCLPRLAPAPRGPVEKDTVSALSSQALSPRRPWSPSKEAGSHLPLTPKH
SLTKSYSSPQRHSPAREPLASAPSPPGSQTGPLPCGSPRLELSPLALHPLGRELPLRARL
PPERKGAADPGPPRHSPTRRWSPGQAESPPRSALPARPRLYLTSFSAEAQRRPAPPHGLG
LKLKFLVVKNGGRRLRAWAPAHPLFSRPFSAPHDFHGHSPARTENIFSHLPLHSQRLTRA
PCPLIPIGGIQMVQARPGAHPILLPGPS
Download sequence
Identical sequences F1MBK6
ENSBTAP00000027644 ENSBTAP00000027644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]